(data stored in ACNUC10821 zone)

EMBL: AP010958.YBCH

AP010958.YBCH        Location/Qualifiers
FT   CDS             complement(619421..620311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="ECO103_0568"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29433"
FT                   /db_xref="InterPro:IPR027849"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2S5"
FT                   /protein_id="BAI29433.1"
FT                   /translation="MRKFIFVLLTLLLVSPFSFAMKGIIWQPQNRDSQVTDTQWQGLMS
FT                   QLRLQGFDPLVLQWTRYGDAFTQPEQRALLFKRAAAAQQAGLKLIVGLNADPEFFMHQK
FT                   QSSAALESYLNRLLAADLQQARLWSAAPGVTPDGWYISAEIDDLNWRSEAARQPLLTWL
FT                   NNAQRLISDVSAKPVYISSFFAGNMSPDGYRQLLEQVKATGVNVWVQDGSGVDKLTAEQ
FT                   RERYLQASADCQSPAPASGIVYELFVAGKGKTFTAKPKPDAEIASLLAKRSSCGKDTLY
FT                   FSLRYLPVAHGILEY"
     MRKFIFVLLT LLLVSPFSFA MKGIIWQPQN RDSQVTDTQW QGLMSQLRLQ GFDPLVLQWT        60
     RYGDAFTQPE QRALLFKRAA AAQQAGLKLI VGLNADPEFF MHQKQSSAAL ESYLNRLLAA       120
     DLQQARLWSA APGVTPDGWY ISAEIDDLNW RSEAARQPLL TWLNNAQRLI SDVSAKPVYI       180
     SSFFAGNMSP DGYRQLLEQV KATGVNVWVQ DGSGVDKLTA EQRERYLQAS ADCQSPAPAS       240
     GIVYELFVAG KGKTFTAKPK PDAEIASLLA KRSSCGKDTL YFSLRYLPVA HGILEY           296
//

If you have problems or comments...

PBIL Back to PBIL home page