(data stored in SCRATCH zone)

EMBL: AP010958.YBDD

AP010958.YBDD        Location/Qualifiers
FT   CDS             669973..670170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdD"
FT                   /locus_tag="ECO103_0607"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29471"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2W3"
FT                   /protein_id="BAI29471.1"
FT                   /translation="MFDSLAKAGKYLGQAAKLMIGMPDYDNYVEHMRVNHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
     MFDSLAKAGK YLGQAAKLMI GMPDYDNYVE HMRVNHPDQT PMTYEEFFRE RQDARYGGKG        60
     GARCC                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page