(data stored in SCRATCH zone)

EMBL: AP010958.YBDM

AP010958.YBDM        Location/Qualifiers
FT   CDS             complement(672538..673167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="ECO103_0610"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29474"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2W6"
FT                   /protein_id="BAI29474.1"
FT                   /translation="MGDTMQQRLTQDLTQFLASLPEDDRIKAINEIRMAIHQVSPFREE
FT                   PVDCVLWVKNSQLMPNDYNPNNVAPPEKKLLKKSIEIDGFTQPIVVTHTDKNALEIVDG
FT                   FHRHEIGKGSSSLKLRLKGYLPVTCLEGTRNQRIAATIRHNRARGRHQITAMSEIVREL
FT                   SQLGWDDNKIGKELGMDSDEVLRLKQINGLQELFADRQYSRAWTVK"
     MGDTMQQRLT QDLTQFLASL PEDDRIKAIN EIRMAIHQVS PFREEPVDCV LWVKNSQLMP        60
     NDYNPNNVAP PEKKLLKKSI EIDGFTQPIV VTHTDKNALE IVDGFHRHEI GKGSSSLKLR       120
     LKGYLPVTCL EGTRNQRIAA TIRHNRARGR HQITAMSEIV RELSQLGWDD NKIGKELGMD       180
     SDEVLRLKQI NGLQELFADR QYSRAWTVK                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page