(data stored in SCRATCH zone)

EMBL: AP010958.YBDN

AP010958.YBDN        Location/Qualifiers
FT   CDS             complement(673140..674360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /locus_tag="ECO103_0611"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29475"
FT                   /db_xref="GOA:C8U2W7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR021845"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2W7"
FT                   /protein_id="BAI29475.1"
FT                   /translation="MSIYKIPLPLNILEAARERITWTLNTLPRVCVSFSGGKDSGLMLH
FT                   LTAELARQMGKKICVLFIDWEAQFSCTINYVQSLRELYTDVIEEFYWVALPLTTQNSLS
FT                   QFQPEWQCWEPDVEWVRQPPQDAITDPDFFCFYQPGMTFEQFVREFAEWFSQKRPAAMM
FT                   IGIRADESYNRFVAIASLNKQRFADDKPWTTAAPGGHSWYIYPIYDWKVADIWTWYANH
FT                   QSLCNPLYNLMYQAGVPLRHMRICEPFGPEQRQGLWLYHVIEPDRWAAMCARVSGVKSG
FT                   GIYAGHDNHFYGHRKILKPEHLDWQEYALLLLNSMPEKTAEHYRNKIAIYLHWYQKKGI
FT                   EVPQTQQGDIGAKDIPSWRRICKVLLNNDYWCRALSFSPTKAKNYQRYNERIKGKRQEW
FT                   GILCNND"
     MSIYKIPLPL NILEAARERI TWTLNTLPRV CVSFSGGKDS GLMLHLTAEL ARQMGKKICV        60
     LFIDWEAQFS CTINYVQSLR ELYTDVIEEF YWVALPLTTQ NSLSQFQPEW QCWEPDVEWV       120
     RQPPQDAITD PDFFCFYQPG MTFEQFVREF AEWFSQKRPA AMMIGIRADE SYNRFVAIAS       180
     LNKQRFADDK PWTTAAPGGH SWYIYPIYDW KVADIWTWYA NHQSLCNPLY NLMYQAGVPL       240
     RHMRICEPFG PEQRQGLWLY HVIEPDRWAA MCARVSGVKS GGIYAGHDNH FYGHRKILKP       300
     EHLDWQEYAL LLLNSMPEKT AEHYRNKIAI YLHWYQKKGI EVPQTQQGDI GAKDIPSWRR       360
     ICKVLLNNDY WCRALSFSPT KAKNYQRYNE RIKGKRQEWG ILCNND                      406
//

If you have problems or comments...

PBIL Back to PBIL home page