(data stored in ACNUC10821 zone)

EMBL: AP010958.YBEL

AP010958.YBEL        Location/Qualifiers
FT   CDS             712699..713181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeL"
FT                   /locus_tag="ECO103_0650"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29513"
FT                   /db_xref="InterPro:IPR009912"
FT                   /db_xref="UniProtKB/TrEMBL:C8U305"
FT                   /protein_id="BAI29513.1"
FT                   /translation="MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTR
FT                   TEVDELTRAVRRDLEEFAMSYEESLKEESDSVFIRVIKESLWQELADITDKTQLEWREV
FT                   FQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRPFEP"
     MNKVAQYYRE LVASLSERLR NGERDIDALV EQARERVIKT GELTRTEVDE LTRAVRRDLE        60
     EFAMSYEESL KEESDSVFIR VIKESLWQEL ADITDKTQLE WREVFQDLNH HGVYHSGEVV       120
     GLGNLVCEKC HFHLPIYTPE VLTLCPKCGH DQFQRRPFEP                             160
//

If you have problems or comments...

PBIL Back to PBIL home page