(data stored in ACNUC10821 zone)

EMBL: AP010958.YBER

AP010958.YBER        Location/Qualifiers
FT   CDS             714392..715099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeR"
FT                   /locus_tag="ECO103_0652"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29515"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:C8U307"
FT                   /protein_id="BAI29515.1"
FT                   /translation="MDMESQKILFALSTPMEIRNECCLPSHSSPKMYLGTCFFDLSSSW
FT                   GIDARDDLLRTIHRMIDNGHAARLAGFYHRWFRYSPCEWRDYLAELNEQGQAYAQFVAS
FT                   TAECCGEGGIKAWDYVRMGFLSRMGVLNNWLSEEESLWIQSRIHLRALRYYRNWRQYFA
FT                   GYTFGRQYWQSPEDDHLQLLREFLARKEYDDSGNDMFYQLFASDDAYYPTLSWQPLAYY
FT                   SACPETLKDMSDL"
     MDMESQKILF ALSTPMEIRN ECCLPSHSSP KMYLGTCFFD LSSSWGIDAR DDLLRTIHRM        60
     IDNGHAARLA GFYHRWFRYS PCEWRDYLAE LNEQGQAYAQ FVASTAECCG EGGIKAWDYV       120
     RMGFLSRMGV LNNWLSEEES LWIQSRIHLR ALRYYRNWRQ YFAGYTFGRQ YWQSPEDDHL       180
     QLLREFLARK EYDDSGNDMF YQLFASDDAY YPTLSWQPLA YYSACPETLK DMSDL            235
//

If you have problems or comments...

PBIL Back to PBIL home page