(data stored in ACNUC10821 zone)

EMBL: AP010958.YBET

AP010958.YBET        Location/Qualifiers
FT   CDS             complement(716533..717087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeT"
FT                   /locus_tag="ECO103_0654"
FT                   /product="conserved predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29517"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C8U309"
FT                   /protein_id="BAI29517.1"
FT                   /translation="MNKKLMYIFAIFIVAAITCISQPKKTTLRDKAMVNYAFDYLSSPG
FT                   SLPLTTAATELSAIHGHSTSQYRLGEFYLHGSDGKPLDYTQARYWYEQSAEQENPRAQS
FT                   KLGWIYLKGLGVKPDTRKAILWYKEAAEQGYAHAQYTLGLIYRNGTGINVNHYESQKWL
FT                   KLAAKQHYKNAERLLAGLPAH"
     MNKKLMYIFA IFIVAAITCI SQPKKTTLRD KAMVNYAFDY LSSPGSLPLT TAATELSAIH        60
     GHSTSQYRLG EFYLHGSDGK PLDYTQARYW YEQSAEQENP RAQSKLGWIY LKGLGVKPDT       120
     RKAILWYKEA AEQGYAHAQY TLGLIYRNGT GINVNHYESQ KWLKLAAKQH YKNAERLLAG       180
     LPAH                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page