(data stored in ACNUC10821 zone)

EMBL: AP010958.YBEY

AP010958.YBEY        Location/Qualifiers
FT   CDS             complement(730368..730835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeY"
FT                   /locus_tag="ECO103_0666"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0666"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29529"
FT                   /db_xref="GOA:C8U321"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:C8U321"
FT                   /protein_id="BAI29529.1"
FT                   /translation="MSQVILDLQLACEDNSGLPEESQFQTWLNAVIPQFQEESEVTIRV
FT                   VDTAESHSLNLTYRGKDKPTNVLSFPFEVPPGMEMSLLGDLVICRQVVEKEAQEQGKPL
FT                   EAHWAHMVVHGSLHLLGYDHIEDDEAEEMEALETEIMLALGYEDPYIAEKE"
     MSQVILDLQL ACEDNSGLPE ESQFQTWLNA VIPQFQEESE VTIRVVDTAE SHSLNLTYRG        60
     KDKPTNVLSF PFEVPPGMEM SLLGDLVICR QVVEKEAQEQ GKPLEAHWAH MVVHGSLHLL       120
     GYDHIEDDEA EEMEALETEI MLALGYEDPY IAEKE                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page