(data stored in ACNUC10821 zone)

EMBL: AP010958.YBEZ

AP010958.YBEZ        Location/Qualifiers
FT   CDS             complement(730832..731911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeZ"
FT                   /locus_tag="ECO103_0667"
FT                   /product="conserved hypothetical protein"
FT                   /note="contains nucleoside triphosphate hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29530"
FT                   /db_xref="GOA:C8U322"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8U322"
FT                   /protein_id="BAI29530.1"
FT                   /translation="MFSFRRHTDKRNGLNIDTREITLEPADNARLLSLCGPFDDNIKQL
FT                   ERRLGIEINRRDNHFKLTGRPICVTAAADILRSLYVDTAPMSGQIQDIEPEQIHLAIKE
FT                   ARVLEQSAESVPEYGKAVNIKTKRGVIKPRTPNQAQYIANILDHDITFGVGPAGTGKTY
FT                   LAVAAAVDALERQEIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGF
FT                   EKVEKLIERNVIEVAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVIT
FT                   GDVTQIDLPRNTKSGLRHAIEVLADVEEISFNFFHSEDVVRHPVVARIVNAYEAWEEAE
FT                   QKRKAALAAERKREEQEQK"
     MFSFRRHTDK RNGLNIDTRE ITLEPADNAR LLSLCGPFDD NIKQLERRLG IEINRRDNHF        60
     KLTGRPICVT AAADILRSLY VDTAPMSGQI QDIEPEQIHL AIKEARVLEQ SAESVPEYGK       120
     AVNIKTKRGV IKPRTPNQAQ YIANILDHDI TFGVGPAGTG KTYLAVAAAV DALERQEIRR       180
     ILLTRPAVEA GEKLGFLPGD LSQKVDPYLR PLYDALFEML GFEKVEKLIE RNVIEVAPLA       240
     YMRGRTLNDA FIILDESQNT TIEQMKMFLT RIGFNSKAVI TGDVTQIDLP RNTKSGLRHA       300
     IEVLADVEEI SFNFFHSEDV VRHPVVARIV NAYEAWEEAE QKRKAALAAE RKREEQEQK        359
//

If you have problems or comments...

PBIL Back to PBIL home page