(data stored in SCRATCH zone)

EMBL: AP010958.YKFM

AP010958.YKFM        Location/Qualifiers
FT   CDS             complement(238995..239474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfM"
FT                   /locus_tag="ECO103_0211"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29087"
FT                   /db_xref="GOA:C8U1S9"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1S9"
FT                   /protein_id="BAI29087.1"
FT                   /translation="MRLHVKLKEFLSMFFMAILFFPAFNASLFFTGVKPLYSIIKCSTE
FT                   IFYDWRMLILCFGFMSFSFLNIHVILLTIIKSFLIKKTKVVNFATDITIQLTLIFLLIA
FT                   IVIAPLIAPFVTGYVNANYHPCGNNTGIFPGAIYIKNGMKCNNEYISRKEDSAVK"
     MRLHVKLKEF LSMFFMAILF FPAFNASLFF TGVKPLYSII KCSTEIFYDW RMLILCFGFM        60
     SFSFLNIHVI LLTIIKSFLI KKTKVVNFAT DITIQLTLIF LLIAIVIAPL IAPFVTGYVN       120
     ANYHPCGNNT GIFPGAIYIK NGMKCNNEYI SRKEDSAVK                              159
//

If you have problems or comments...

PBIL Back to PBIL home page