(data stored in ACNUC10821 zone)

EMBL: AP010958.YKGC

AP010958.YKGC        Location/Qualifiers
FT   CDS             complement(318839..320164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgC"
FT                   /locus_tag="ECO103_0280"
FT                   /product="predicted oxidoreductase"
FT                   /note="contains FAD/NAD(P)-binding domain and dimerization
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29153"
FT                   /db_xref="GOA:C8U1Z5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1Z5"
FT                   /protein_id="BAI29153.1"
FT                   /translation="MNKYQAVIIGFGKAGKTLAVTLAKAGWRVALIEQSNAMYGGTCIN
FT                   IGCIPTKTLVHDAQQHTDFVRAIQRKNEVVNFLRNKNFHNLADMPNIDVIDGQAEFINN
FT                   HSLRVHRPEGNLEIHGEKIFINTGAQTVVPPIPGITTTPGVYDSTGLLNLKELPGHLGI
FT                   LGGGYIGVEFASMFANFGSKVTILEAASLFLPREDRDIADNIATILRDQGVDIILNAHV
FT                   ERISHNENQVQVHSEHAQLAVDALLIASGRQPATASLHPENAGIAVNERGAIVVDKQLH
FT                   TTADNIWAMGDVTGGLQFTYISLDDYRIVRDELLGEGRRSTDDRKNVPYSVFMTPPLSR
FT                   VGMTEEQARESGADIQVVTLPVAAIPRARVMNDTRGVLKAIVDNKTQRILGASLLCVDS
FT                   HEMINIVKMVMDAGLPYSILHDQIFTHPSMSESLNDLFSLVK"
     MNKYQAVIIG FGKAGKTLAV TLAKAGWRVA LIEQSNAMYG GTCINIGCIP TKTLVHDAQQ        60
     HTDFVRAIQR KNEVVNFLRN KNFHNLADMP NIDVIDGQAE FINNHSLRVH RPEGNLEIHG       120
     EKIFINTGAQ TVVPPIPGIT TTPGVYDSTG LLNLKELPGH LGILGGGYIG VEFASMFANF       180
     GSKVTILEAA SLFLPREDRD IADNIATILR DQGVDIILNA HVERISHNEN QVQVHSEHAQ       240
     LAVDALLIAS GRQPATASLH PENAGIAVNE RGAIVVDKQL HTTADNIWAM GDVTGGLQFT       300
     YISLDDYRIV RDELLGEGRR STDDRKNVPY SVFMTPPLSR VGMTEEQARE SGADIQVVTL       360
     PVAAIPRARV MNDTRGVLKA IVDNKTQRIL GASLLCVDSH EMINIVKMVM DAGLPYSILH       420
     DQIFTHPSMS ESLNDLFSLV K                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page