(data stored in ACNUC10821 zone)

EMBL: AP010958.YKGI

AP010958.YKGI        Location/Qualifiers
FT   CDS             complement(318494..318730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgI"
FT                   /locus_tag="ECO103_0279"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29152"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1Z4"
FT                   /protein_id="BAI29152.1"
FT                   /translation="MFKKSVLFATLLSGVMAFSTNADDKIILKHISVSSVSASPTVLED
FT                   TIADIARKYNASSWKVTSMRIDNNSTATAVLYK"
     MFKKSVLFAT LLSGVMAFST NADDKIILKH ISVSSVSASP TVLEDTIADI ARKYNASSWK        60
     VTSMRIDNNS TATAVLYK                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page