(data stored in ACNUC10821 zone)

EMBL: AP010958.YLAB

AP010958.YLAB        Location/Qualifiers
FT   CDS             complement(485656..487206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="ECO103_0433"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29301"
FT                   /db_xref="GOA:C8U2E3"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2E3"
FT                   /protein_id="BAI29301.1"
FT                   /translation="MRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVETSFIEELDTYS
FT                   SRVAIRANKVATQGKDALQELERWQGAACSEAHLMEMRRVSYSYRYIQEVVYIDNNVPQ
FT                   CSSLEHESPPDTFPEPGKISKDGYRVWLTSHNDLGIIRYMVAMGTAHYVVMIDPASFID
FT                   VIPYSSWQIDAAIIGNAHNVVITSSDEIAQGIITRLQKTPGEHIENNGIIYDILPFPEM
FT                   NISIITWASTKMLQKGWHRQVFIWLPLGLVIGLLAAMFVLRILRRIQSPHHRLQDAIEN
FT                   RDICVHYQPIVSLANGKIVGAEALARWPQTDGSWLSPDSFIPLAQQTGLSEPLTLLIIR
FT                   SVFEDMGDWLRQHPQQHISINLESTVLTSEKIPQLLREMINHYQVNPRQIALELTEREF
FT                   ADPKTSAPIISRYREAGHEIYLDDFGTGYSSLSYLQDLDVDILKIDKSFVDALEYKNVT
FT                   PHIIEMAKTLKLKMVAEGIETSKQEEWLRQHGVHYGQGWLYSKALPKEDFLRWAEQHL"
     MRTRHLVGLI SGVLILSVLL PVGLSIWLAH QQVETSFIEE LDTYSSRVAI RANKVATQGK        60
     DALQELERWQ GAACSEAHLM EMRRVSYSYR YIQEVVYIDN NVPQCSSLEH ESPPDTFPEP       120
     GKISKDGYRV WLTSHNDLGI IRYMVAMGTA HYVVMIDPAS FIDVIPYSSW QIDAAIIGNA       180
     HNVVITSSDE IAQGIITRLQ KTPGEHIENN GIIYDILPFP EMNISIITWA STKMLQKGWH       240
     RQVFIWLPLG LVIGLLAAMF VLRILRRIQS PHHRLQDAIE NRDICVHYQP IVSLANGKIV       300
     GAEALARWPQ TDGSWLSPDS FIPLAQQTGL SEPLTLLIIR SVFEDMGDWL RQHPQQHISI       360
     NLESTVLTSE KIPQLLREMI NHYQVNPRQI ALELTEREFA DPKTSAPIIS RYREAGHEIY       420
     LDDFGTGYSS LSYLQDLDVD ILKIDKSFVD ALEYKNVTPH IIEMAKTLKL KMVAEGIETS       480
     KQEEWLRQHG VHYGQGWLYS KALPKEDFLR WAEQHL                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page