(data stored in ACNUC10821 zone)

EMBL: AP010958.YLBF

AP010958.YLBF        Location/Qualifiers
FT   CDS             556821..557636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="ECO103_0492"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29359"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2K1"
FT                   /protein_id="BAI29359.1"
FT                   /translation="MTIIHPLLASRSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQ
FT                   GSGFGPGGWVLRRAQFDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPSH
FT                   PQPLAAAWMQRAEETGLFGPLAMAASDPLTAELRQFRHCFQAALNGVKTDWRHWLGKGP
FT                   GLTPSHDDTLSGMLLAAWYYGALDARSGRQFFACSDNLQLVTTAVSVSYLRYAAQGYFA
FT                   SPLLHFVHALSCPKRTAVAIDSLLALGHTSGADTLLGFWLGQQLLQGTP"
     MTIIHPLLAS RSAPNYRQSW RLAGVWRRAI NLMTESGELL TLHRQGSGFG PGGWVLRRAQ        60
     FDALCGGLCG NERPQVVAQG IRLGRFTVKQ PQRYCLLRIT PPSHPQPLAA AWMQRAEETG       120
     LFGPLAMAAS DPLTAELRQF RHCFQAALNG VKTDWRHWLG KGPGLTPSHD DTLSGMLLAA       180
     WYYGALDARS GRQFFACSDN LQLVTTAVSV SYLRYAAQGY FASPLLHFVH ALSCPKRTAV       240
     AIDSLLALGH TSGADTLLGF WLGQQLLQGT P                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page