(data stored in SCRATCH zone)

EMBL: AP010960.LFHB

AP010960.LFHB        Location/Qualifiers
FT   CDS             complement(283277..284416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfhB"
FT                   /locus_tag="ECO111_0253"
FT                   /product="predicted lateral flagellar export pore protein"
FT                   /note="FlhB-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34242"
FT                   /db_xref="GOA:C8UHA9"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:C8UHA9"
FT                   /protein_id="BAI34242.1"
FT                   /translation="MADSSSEEKTEKPSAQKLRKAREEGQLPRSKDMGLAASLFAAFVV
FT                   ISSSFPWYADFVRESFISVHQYAQEINNPEVIGQFLRHHLLILGKFILTLLPMPAAALL
FT                   SSLVPGGWLFLPKKILPDFSKISPLKGIGRLFSSEHLAETGKMTVKSVVVLVMLWVSLR
FT                   NNFASFLGLQALPFKLAMNEGLSLYACVMRNFVILFIFFALIDVPLAKALFTKGLKMTK
FT                   QELKEEYKNQEGKPEVKARVRRLQRQLAMGQIRKVVPKANVVITNPTHYAVALQYDSSR
FT                   AAAPFVVAKGTDEIALYIRQVAAENQVEVVEFPRLARSVYYTTQVNQQIPFQLYRAIAH
FT                   VLTYVLQMKHWREGAQPRPALNRHISIPKEVLKLDGENN"
     MADSSSEEKT EKPSAQKLRK AREEGQLPRS KDMGLAASLF AAFVVISSSF PWYADFVRES        60
     FISVHQYAQE INNPEVIGQF LRHHLLILGK FILTLLPMPA AALLSSLVPG GWLFLPKKIL       120
     PDFSKISPLK GIGRLFSSEH LAETGKMTVK SVVVLVMLWV SLRNNFASFL GLQALPFKLA       180
     MNEGLSLYAC VMRNFVILFI FFALIDVPLA KALFTKGLKM TKQELKEEYK NQEGKPEVKA       240
     RVRRLQRQLA MGQIRKVVPK ANVVITNPTH YAVALQYDSS RAAAPFVVAK GTDEIALYIR       300
     QVAAENQVEV VEFPRLARSV YYTTQVNQQI PFQLYRAIAH VLTYVLQMKH WREGAQPRPA       360
     LNRHISIPKE VLKLDGENN                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page