(data stored in SCRATCH zone)

EMBL: AP010960.NFRB

AP010960.NFRB        Location/Qualifiers
FT   CDS             complement(627333..629570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrB"
FT                   /locus_tag="ECO111_0590"
FT                   /product="bacteriophage N4 receptor inner membrane subunit
FT                   NfrB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34564"
FT                   /db_xref="GOA:C8UJN1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:C8UJN1"
FT                   /protein_id="BAI34564.1"
FT                   /translation="MDWLLDVFATWLYGLKVIAITLAVIMFISGLDDFFIDVVYWVRRI
FT                   KRKLSVYRRYPRMSYRELYKPDEKPLAIMVPAWNETGVIGNMAELAATTLDYENYHIFV
FT                   GTYPNDPDTQRDVDEVCARFPNVHKVVCARPGPTSKADCLNNVLDAITQFERSANFAFA
FT                   GFILHDAEDVISPMELRLFNYLVERKDLIQIPVYPFEREWTHFTSMTYIDEFSELHGKD
FT                   VPVREALAGQVPSAGVGTCFSRRAVTALLADGDGIAFDVQSLTEDYDIGFRLKEKGMTE
FT                   IFVRFPVVDEAKEREQRKFLQHARTSNMICVREYFPDTFSTAVRQKSRWIIGIVFQGFK
FT                   THKWTSSLTLNYFLWRDRKGAISNFVSFLAMLVMLQLLLLLAYESLWPDAWHFLSIFSG
FT                   SAWLMTLLWLNFGLMFNRIVQRVIFVTGYYGLTQGLLSVLRLFWGNLINFMANWRALKQ
FT                   VLQHGDPRRVAWDKTTHDFPSVTGDTRSLRSLGQILLENQVITEEQLDTALRNRVEGLR
FT                   LGGSMLMQGLISAEQLAQALAEQNGVAWESIDAWQIPSSLIAEMPASVALHYAVLPLRL
FT                   ENDELIVGSEDGIDPVSLAALTRKVGRKVRYVIVLRGQIVTGLRHWYARRRGHDPRAML
FT                   YNAVQHQWLTEQQTGEIWRQYVPHQFLFAEILTTLGHINRSAINVLLLRHERSSLPLGK
FT                   FLVTEGVISQETLDRVLTIQRELQVSMQSLLLKAGLNTEQVAQLESENEGE"
     MDWLLDVFAT WLYGLKVIAI TLAVIMFISG LDDFFIDVVY WVRRIKRKLS VYRRYPRMSY        60
     RELYKPDEKP LAIMVPAWNE TGVIGNMAEL AATTLDYENY HIFVGTYPND PDTQRDVDEV       120
     CARFPNVHKV VCARPGPTSK ADCLNNVLDA ITQFERSANF AFAGFILHDA EDVISPMELR       180
     LFNYLVERKD LIQIPVYPFE REWTHFTSMT YIDEFSELHG KDVPVREALA GQVPSAGVGT       240
     CFSRRAVTAL LADGDGIAFD VQSLTEDYDI GFRLKEKGMT EIFVRFPVVD EAKEREQRKF       300
     LQHARTSNMI CVREYFPDTF STAVRQKSRW IIGIVFQGFK THKWTSSLTL NYFLWRDRKG       360
     AISNFVSFLA MLVMLQLLLL LAYESLWPDA WHFLSIFSGS AWLMTLLWLN FGLMFNRIVQ       420
     RVIFVTGYYG LTQGLLSVLR LFWGNLINFM ANWRALKQVL QHGDPRRVAW DKTTHDFPSV       480
     TGDTRSLRSL GQILLENQVI TEEQLDTALR NRVEGLRLGG SMLMQGLISA EQLAQALAEQ       540
     NGVAWESIDA WQIPSSLIAE MPASVALHYA VLPLRLENDE LIVGSEDGID PVSLAALTRK       600
     VGRKVRYVIV LRGQIVTGLR HWYARRRGHD PRAMLYNAVQ HQWLTEQQTG EIWRQYVPHQ       660
     FLFAEILTTL GHINRSAINV LLLRHERSSL PLGKFLVTEG VISQETLDRV LTIQRELQVS       720
     MQSLLLKAGL NTEQVAQLES ENEGE                                             745
//

If you have problems or comments...

PBIL Back to PBIL home page