(data stored in SCRATCH zone)

EMBL: AP010960.PE218

AP010960.PE218       Location/Qualifiers
FT   CDS             complement(241826..243178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO111_0218"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34213"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:C8UH80"
FT                   /protein_id="BAI34213.1"
FT                   /translation="MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLV
FT                   ESLALAIFKANGVDLHTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPA
FT                   RTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLL
FT                   YFMQNTRKRLGPQLKSNTENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVR
FT                   SLTENPPQASVINQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAAT
FT                   VWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALK
FT                   TRAQSSPQLRGWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESL
FT                   LTQYHDARAQKQNTDALEKQINERLEGVLSRWLLLKNNVMPEAATGTTAEK"
     MNSNVLTQTI VTGSDPRGLP EFSAIREEIN KASHPSQPEL NWKLVESLAL AIFKANGVDL        60
     HTATYYTLAR TRTQGLAGFC EGAELLAAMV SHDWDKFWPQ GGPARTEMLD WFNSRTGNIL       120
     RQQISFAESD LPLIYRTERA LQLICDKLQQ VELKRVPRVE NLLYFMQNTR KRLGPQLKSN       180
     TENAAQTTVR TLIYAPETQA SSTPEAVVPP LPGLPEMKVE VRSLTENPPQ ASVINQGSTV       240
     RGFIAGIACS VAVASALWWW QVYPVQQQLL QVNDTAQGAA TVWMASPELE NYERRLQQLL       300
     DTSPVQPLET GMQMMRVADS RWPESLQQQQ ASTQWNEALK TRAQSSPQLR GWLQTRQDLH       360
     AFADLVMQRE KEGLTLSYIK NVIWQAERGL GQETPVESLL TQYHDARAQK QNTDALEKQI       420
     NERLEGVLSR WLLLKNNVMP EAATGTTAEK                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page