(data stored in SCRATCH zone)

EMBL: AP010960.PE315

AP010960.PE315       Location/Qualifiers
FT   CDS             complement(336674..337084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO111_0315"
FT                   /product="hypothetical protein"
FT                   /note="Integrative element ECO111_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0315"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34302"
FT                   /db_xref="UniProtKB/TrEMBL:C8UI74"
FT                   /protein_id="BAI34302.1"
FT                   /translation="MKAFILSLIVSGLLLSASVNATEVKLPRTVIDVKDGSEQMCGSED
FT                   IKDGICSLIGVSDDGKYALLSSPGGSACYDPYIIVVNLATSKGKMMDYNRHATCSGEAT
FT                   AKFVRSSDKDHLTVVIYDPSIKKNVGLNTIDF"
     MKAFILSLIV SGLLLSASVN ATEVKLPRTV IDVKDGSEQM CGSEDIKDGI CSLIGVSDDG        60
     KYALLSSPGG SACYDPYIIV VNLATSKGKM MDYNRHATCS GEATAKFVRS SDKDHLTVVI       120
     YDPSIKKNVG LNTIDF                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page