(data stored in SCRATCH zone)

EMBL: AP010960.PE329

AP010960.PE329       Location/Qualifiers
FT   CDS             345239..345466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO111_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34316"
FT                   /db_xref="UniProtKB/TrEMBL:C8UI88"
FT                   /protein_id="BAI34316.1"
FT                   /translation="MQAAPQREETEWRVQSKRGLMPAYRGEAGQQVNIKIMEYSERNVR
FT                   QLASNEQEEYIPRKINVGVINTPTLIRSDY"
     MQAAPQREET EWRVQSKRGL MPAYRGEAGQ QVNIKIMEYS ERNVRQLASN EQEEYIPRKI        60
     NVGVINTPTL IRSDY                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page