(data stored in SCRATCH zone)

EMBL: AP010960.PE459

AP010960.PE459       Location/Qualifiers
FT   CDS             complement(487735..488277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO111_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34438"
FT                   /db_xref="GOA:C8UIL0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8UIL0"
FT                   /protein_id="BAI34438.1"
FT                   /translation="MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASL
FT                   KKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEKQRVSGVLQGSQPSEIGVVRLVMLG
FT                   VARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSATPN
FT                   AFGAVPMFLAIQHILAA"
     MVDKHEEITL PIVLSCNYQS DITYPGQKQF DCGNPVIDKF VRASLKKSVR NSDCAAKALI        60
     DRQSGELIGI CTFTAYSLEK QRVSGVLQGS QPSEIGVVRL VMLGVARKYQ KRGFGQDLLC       120
     DFFEHVKIIH QALPIKGVYL DADPAAINFY ARLGFVQLSA TPNAFGAVPM FLAIQHILAA       180
//

If you have problems or comments...

PBIL Back to PBIL home page