(data stored in SCRATCH zone)

EMBL: AP010960.PE52

AP010960.PE52        Location/Qualifiers
FT   CDS             complement(53013..53612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO111_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34053"
FT                   /db_xref="InterPro:IPR025633"
FT                   /db_xref="UniProtKB/TrEMBL:C8UGS0"
FT                   /protein_id="BAI34053.1"
FT                   /translation="MADYFEIRADYNQHTITIYQAYNDAIADVAVRDGRFGAPFSFNRM
FT                   TWIKPSFMWMMERSNWGLKKDQQHILAIRIKRTFFDTLLEQAVLTTPEAHVYPHAGIWE
FT                   TLFAQANVYVQWDPERSINGKKLEHRSLQLGISRNLISQFNEDAIVAIDDLTPLVRKCH
FT                   NLLINGKTTQAKSFLPPEKIYPVSAAARKALGMKNS"
     MADYFEIRAD YNQHTITIYQ AYNDAIADVA VRDGRFGAPF SFNRMTWIKP SFMWMMERSN        60
     WGLKKDQQHI LAIRIKRTFF DTLLEQAVLT TPEAHVYPHA GIWETLFAQA NVYVQWDPER       120
     SINGKKLEHR SLQLGISRNL ISQFNEDAIV AIDDLTPLVR KCHNLLINGK TTQAKSFLPP       180
     EKIYPVSAAA RKALGMKNS                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page