(data stored in SCRATCH zone)

EMBL: AP010960.SFMF

AP010960.SFMF        Location/Qualifiers
FT   CDS             606305..606820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmF"
FT                   /locus_tag="ECO111_0566"
FT                   /product="predicted fimbrial-like adhesin protein SfmF"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34541"
FT                   /db_xref="GOA:C8UJK8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C8UJK8"
FT                   /protein_id="BAI34541.1"
FT                   /translation="MRRVLFSCFCGLLWSSIGWAADPLGTININLHGNVVDFSCTVNTA
FT                   DIDKTVDLGRWPTTQLLNAGDTTALVPFSLRLEGCPPGSVAILFTGTPASDTNLLALDD
FT                   PAMAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGVAKAD
FT                   AIFMINYN"
     MRRVLFSCFC GLLWSSIGWA ADPLGTININ LHGNVVDFSC TVNTADIDKT VDLGRWPTTQ        60
     LLNAGDTTAL VPFSLRLEGC PPGSVAILFT GTPASDTNLL ALDDPAMAQT VAIELRNSDR       120
     SRLALGEASP TEEVDANGNV TLNFFANYRA LASGVRPGVA KADAIFMINY N                171
//

If you have problems or comments...

PBIL Back to PBIL home page