(data stored in SCRATCH zone)

EMBL: AP010960.YAHF

AP010960.YAHF        Location/Qualifiers
FT   CDS             376863..378410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahF"
FT                   /locus_tag="ECO111_0355"
FT                   /product="predicted acyl-CoA synthetase"
FT                   /note="contains NAD(P)-binding domain and succinyl-CoA
FT                   synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34340"
FT                   /db_xref="GOA:C8UIB2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:C8UIB2"
FT                   /protein_id="BAI34340.1"
FT                   /translation="MSVKIVIKPNTYFDSVSLMSISTRANKLDGVEQAFVAMATEMNKG
FT                   VLKNLGLLTPELEQAKNGDLMIVINGKSGADNEQLLVEIEELFNTKAQSGSHEARYATI
FT                   ASAKKHIPESNLAVISVNGLFAAREARQALQNDLNVMLFSDNVSVEDELALKQLAHEKG
FT                   LLMMGPDCGTAIINGAALCFGNAVRRGNIGIVGASGTGSQELSVRIHEFGGGVSQLIGT
FT                   GGRDLSEKIGGLMMLDAIGMLENDPQTEIIALISKPPAPAVARKVLERARACRKPVVVC
FT                   FLGRVETPVDEQGLQFARGSKEAALKAVMLSGVKQENLDLHTLNQPLIADVRARLQPQQ
FT                   KYIRGLFCGGTLCDETMFAVMEKHGDVYSNIPPDPEFRLQDINRSIKHTFLDFGDDDFT
FT                   NGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIEAIKEAKAIAA
FT                   AEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGLLAREFICKGEEA"
     MSVKIVIKPN TYFDSVSLMS ISTRANKLDG VEQAFVAMAT EMNKGVLKNL GLLTPELEQA        60
     KNGDLMIVIN GKSGADNEQL LVEIEELFNT KAQSGSHEAR YATIASAKKH IPESNLAVIS       120
     VNGLFAAREA RQALQNDLNV MLFSDNVSVE DELALKQLAH EKGLLMMGPD CGTAIINGAA       180
     LCFGNAVRRG NIGIVGASGT GSQELSVRIH EFGGGVSQLI GTGGRDLSEK IGGLMMLDAI       240
     GMLENDPQTE IIALISKPPA PAVARKVLER ARACRKPVVV CFLGRVETPV DEQGLQFARG       300
     SKEAALKAVM LSGVKQENLD LHTLNQPLIA DVRARLQPQQ KYIRGLFCGG TLCDETMFAV       360
     MEKHGDVYSN IPPDPEFRLQ DINRSIKHTF LDFGDDDFTN GKPHPMIDPT NRISRLIEEA       420
     RDPEVAVIVM DFVLGFGSHE DPVGSTIEAI KEAKAIAAAE GRELIILAYV LGTDLDTPSL       480
     EQQSQMLLDA GVILASSSTN TGLLAREFIC KGEEA                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page