(data stored in SCRATCH zone)

EMBL: AP010960.YAHG

AP010960.YAHG        Location/Qualifiers
FT   CDS             378410..379828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="ECO111_0356"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34341"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:C8UIB3"
FT                   /protein_id="BAI34341.1"
FT                   /translation="MSQSLFSQPLNVINVGIAMFSDDLKKQHVEVTQLDWTPPGQGNMQ
FT                   VVQALDNIADSPLADKIAAANQQALERIIQSHPVLIGFDQAINVVPGMTPKTILHAGPP
FT                   ITWEKMCGAMKGAVTGALVFEGLAKDLDEAAELAASGEITFSPCHEHDCVGSMAGVTSA
FT                   SMFMHIVKNKTYGNIAYTNMSEQMAKILRMGANDQSVIDRLNWMRDVQGPMLRDAMKII
FT                   GEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVEKQREVFEFVASSD
FT                   YFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGP
FT                   MFAGYKPEDSGLDIGDSAITETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREITL
FT                   GENPNVTIPLLGFMGVPSAIDITRVGSSGILPVINTAIAHKDAGVGMIGAGIVHPPFAC
FT                   FEKAILGWCERYGV"
     MSQSLFSQPL NVINVGIAMF SDDLKKQHVE VTQLDWTPPG QGNMQVVQAL DNIADSPLAD        60
     KIAAANQQAL ERIIQSHPVL IGFDQAINVV PGMTPKTILH AGPPITWEKM CGAMKGAVTG       120
     ALVFEGLAKD LDEAAELAAS GEITFSPCHE HDCVGSMAGV TSASMFMHIV KNKTYGNIAY       180
     TNMSEQMAKI LRMGANDQSV IDRLNWMRDV QGPMLRDAMK IIGEIDLRLM LAQALHMGDE       240
     CHNRNNAGTT LLIQALTPGI IQAGYSVEKQ REVFEFVASS DYFSGPTWMA MCKAAMDAAH       300
     GIEYSTVVTT MARNGVEFGL RVSGLPGQWF TGPAQQVIGP MFAGYKPEDS GLDIGDSAIT       360
     ETYGIGGFAM ATAPAIVALV GGTVEEAIDF SRQMREITLG ENPNVTIPLL GFMGVPSAID       420
     ITRVGSSGIL PVINTAIAHK DAGVGMIGAG IVHPPFACFE KAILGWCERY GV               472
//

If you have problems or comments...

PBIL Back to PBIL home page