(data stored in SCRATCH zone)

EMBL: AP010960.YAJL

AP010960.YAJL        Location/Qualifiers
FT   CDS             complement(482721..483311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajL"
FT                   /locus_tag="ECO111_0454"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34433"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8UIK5"
FT                   /protein_id="BAI34433.1"
FT                   /translation="MSASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAI
FT                   TCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAA
FT                   ICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE"
     MSASALVCLA PGSEETEAVT TIDLLVRGGI KVTTASVASD GNLAITCSRG VKLLADAPLV        60
     EVADGEYDVI VLPGGIKGAE CFRDSTLLVE TVKQFHRSGR IVAAICAAPA TVLVPHDIFP       120
     IGNMTGFPTL KDKIPAEQWQ DKRVVWDARV KLLTSQGPGT AIDFGLKIID LLVGREKAHE       180
     VASQLVMAAG IYNYYE                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page