(data stored in SCRATCH zone)

EMBL: AP010960.YBAD

AP010960.YBAD        Location/Qualifiers
FT   CDS             472672..473121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaD"
FT                   /locus_tag="ECO111_0443"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34422"
FT                   /db_xref="GOA:C8UIJ4"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:C8UIJ4"
FT                   /protein_id="BAI34422.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLED"
     MHCPFCFAVD TKVIDSRLVG EGSSVRRRRQ CLVCNERFTT FEVAELVMPR VVKSNDVREP        60
     FNEEKLRSGM LRALEKRPVS SDDVEMAINH IKSQLRATGE REVPSKMIGN LVMEQLKKLD       120
     KVAYIRFASV YRSFEDIKEF GEEIARLED                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page