(data stored in SCRATCH zone)

EMBL: AP010960.YBCI

AP010960.YBCI        Location/Qualifiers
FT   CDS             complement(598969..599490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="ECO111_0559"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34534"
FT                   /db_xref="GOA:C8UJK1"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:C8UJK1"
FT                   /protein_id="BAI34534.1"
FT                   /translation="MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSF
FT                   KFGVAYGNVFGHREFTHSLVFAFVVPLLCVLIGRRWFRAGLIRCWLFLTVSLLSHSLLD
FT                   SVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTPYGHQVIISELMWVWLPGMV
FT                   LMGMLWWRRR"
     MPTVITHAAV PLCIGLGLGS KVIPPRLLFA GIILAMLPDA DVLSFKFGVA YGNVFGHREF        60
     THSLVFAFVV PLLCVLIGRR WFRAGLIRCW LFLTVSLLSH SLLDSVTTGG KGVGWLWPWS       120
     DERFFAPWQV IKVAPFALSR YTTPYGHQVI ISELMWVWLP GMVLMGMLWW RRR              173
//

If you have problems or comments...

PBIL Back to PBIL home page