(data stored in SCRATCH zone)

EMBL: AP010960.YBEB

AP010960.YBEB        Location/Qualifiers
FT   CDS             complement(714973..715290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeB"
FT                   /locus_tag="ECO111_0667"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34636"
FT                   /db_xref="GOA:C8UJV3"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:C8UJV3"
FT                   /protein_id="BAI34636.1"
FT                   /translation="MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSS
FT                   RHVMSIADHVVQESRAAGLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLW
FT                   S"
     MQGKALQDFV IDKIDDLKGQ DIIALDVQGK SSITDCMIIC TGTSSRHVMS IADHVVQESR        60
     AAGLLPLGVE GENSADWIVV DLGDVIVHVM QEESRRLYEL EKLWS                       105
//

If you have problems or comments...

PBIL Back to PBIL home page