(data stored in SCRATCH zone)

EMBL: AP010960.YKGI

AP010960.YKGI        Location/Qualifiers
FT   CDS             complement(354593..354829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgI"
FT                   /locus_tag="ECO111_0337"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34322"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C8UI94"
FT                   /protein_id="BAI34322.1"
FT                   /translation="MFKKSVLFATLLSGVMAFSTNADDKIILKHISVSSVSASPTVLED
FT                   TIADIARKYNASSWKVTSMRIDNNSTATAVLYK"
     MFKKSVLFAT LLSGVMAFST NADDKIILKH ISVSSVSASP TVLEDTIADI ARKYNASSWK        60
     VTSMRIDNNS TATAVLYK                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page