(data stored in ACNUC7421 zone)

EMBL: AP011115.ACN

AP011115.ACN         Location/Qualifiers
FT   CDS             55379..58177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acn"
FT                   /locus_tag="ROP_00660"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="protein synonym:aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48313"
FT                   /db_xref="GOA:C1AS64"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS64"
FT                   /protein_id="BAH48313.1"
FT                   /translation="MSGNSFGARSTLTVADQTYGIYRLDAIETDVQLPYSMKVLLENLL
FT                   RNEDGRLVTAGQVSALASWSPRNPGHTEIQFTPARVLMQDFTGVPCVVDLVAMRDAMTA
FT                   LGGDPRKINPLIPTELVIDHSVIADVFGRPDAYRVNADLEFSRNKERYQLLRWAQQAFD
FT                   DFLVVPPDTGICHQVNLEYLARVVFTQETPDGPLAYPDTLVGTDSHTPMINGLGVLGWG
FT                   VGGIEAEAAMLGQPMSMLLPQVLGLKLTGALPEGTTATDLVLTIAELLRKTGVVGKFVE
FT                   FYGPGVANVPLANRATLGNMSPEYGSTCAIFPIDDETLNYLRLTGRPEQQVRLVEAYAK
FT                   EQGMWHDPDQEPAYSHTVELDLATVEPSIAGPKRPQDRIPLASAPHAVGSLLAGQPLPT
FT                   ALDAGLDEASGESFPASDPIAVDHDRASDGPAAPCRCGKSHVWPSDPVEVVLDGEVHSV
FT                   DHGHVVIAAITSCTNTSNPSVMIGAGLLAKKAVQAGLTRKPWVKTSLAPGSRVVTDYYD
FT                   RAGLTPYLERLGFGLVGYGCTTCIGNSGPLISQVSDAVTGHDLTACAVLSGNRNFEGRI
FT                   HAECKMNFLTSPPLVITYALAGTMLADVLHDPIGTGSDGRPVYLRDIWPSTEEVKAVID
FT                   ECLQSQMFTDGYSNVFAGDDNWRGLDVASGEIFEWHEDSTYVRRPPYFDGIQPEPQPIS
FT                   DITGARVLVMLGDSVTTDHISPAGTIRRGSPAGIYLREHGVEPPDFNSYGSRRGNHEVM
FT                   IRGTFANIRLRNLLAPGTEGGVTRHLPDGQEMSIFHAANAYAAEGTALIILAGAEYGSG
FT                   SSRDWAAKGTLLLGVKAVLATSFERIHRSNLIGMGVLPLQFPPGHTRESLGLTGEEEYS
FT                   ITGLEGGDPGADFPTEVTVRAHHHGQVQEFRATVRIDTPAEAGYFRHGGILQYVLRQLL
FT                   VT"
     MSGNSFGARS TLTVADQTYG IYRLDAIETD VQLPYSMKVL LENLLRNEDG RLVTAGQVSA        60
     LASWSPRNPG HTEIQFTPAR VLMQDFTGVP CVVDLVAMRD AMTALGGDPR KINPLIPTEL       120
     VIDHSVIADV FGRPDAYRVN ADLEFSRNKE RYQLLRWAQQ AFDDFLVVPP DTGICHQVNL       180
     EYLARVVFTQ ETPDGPLAYP DTLVGTDSHT PMINGLGVLG WGVGGIEAEA AMLGQPMSML       240
     LPQVLGLKLT GALPEGTTAT DLVLTIAELL RKTGVVGKFV EFYGPGVANV PLANRATLGN       300
     MSPEYGSTCA IFPIDDETLN YLRLTGRPEQ QVRLVEAYAK EQGMWHDPDQ EPAYSHTVEL       360
     DLATVEPSIA GPKRPQDRIP LASAPHAVGS LLAGQPLPTA LDAGLDEASG ESFPASDPIA       420
     VDHDRASDGP AAPCRCGKSH VWPSDPVEVV LDGEVHSVDH GHVVIAAITS CTNTSNPSVM       480
     IGAGLLAKKA VQAGLTRKPW VKTSLAPGSR VVTDYYDRAG LTPYLERLGF GLVGYGCTTC       540
     IGNSGPLISQ VSDAVTGHDL TACAVLSGNR NFEGRIHAEC KMNFLTSPPL VITYALAGTM       600
     LADVLHDPIG TGSDGRPVYL RDIWPSTEEV KAVIDECLQS QMFTDGYSNV FAGDDNWRGL       660
     DVASGEIFEW HEDSTYVRRP PYFDGIQPEP QPISDITGAR VLVMLGDSVT TDHISPAGTI       720
     RRGSPAGIYL REHGVEPPDF NSYGSRRGNH EVMIRGTFAN IRLRNLLAPG TEGGVTRHLP       780
     DGQEMSIFHA ANAYAAEGTA LIILAGAEYG SGSSRDWAAK GTLLLGVKAV LATSFERIHR       840
     SNLIGMGVLP LQFPPGHTRE SLGLTGEEEY SITGLEGGDP GADFPTEVTV RAHHHGQVQE       900
     FRATVRIDTP AEAGYFRHGG ILQYVLRQLL VT                                     932
//

If you have problems or comments...

PBIL Back to PBIL home page