(data stored in ACNUC7421 zone)

EMBL: AP011115.ARC

AP011115.ARC         Location/Qualifiers
FT   CDS             complement(604420..606195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arc"
FT                   /locus_tag="ROP_05870"
FT                   /product="ATPase ARC"
FT                   /EC_number="3.6.-.-"
FT                   /note="protein synonym:AAA family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48834"
FT                   /db_xref="GOA:C1ASQ2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR022482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041626"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASQ2"
FT                   /protein_id="BAH48834.1"
FT                   /translation="MSSTENPDSVAAARELEALRAEASALRRQLAESPEQLREMESRVD
FT                   SLSIRNTKLMDTLKEARQQLIALREEVDRLGQPPSGYGVLLGVHDDQTVDVFTSGRKMR
FT                   LTCSPNVDAETLKLGQTVRLNEALTIVEAGNFERVGEISTLREVLDDGQRALVVGHADE
FT                   ERIVWLAEPLATVFEESERESVAYDAESPTRKLRPGDSLLVDTKAGYAFERIPKAEVED
FT                   LVLEEVPDVHYDDIGGLGRQIEQIRDAVELPFLHKDLFHEYELRPPKGVLLYGPPGCGK
FT                   TLIAKAVANSLAKKIAEARGQDSKEAKSYFLNIKGPELLNKFVGETERHIRLIFQRARE
FT                   KASEGTPVIVFFDEMDSIFRTRGSGVSSDVETTVVPQLLSEIDGVEGLENVIVIGASNR
FT                   EDMIDPAILRPGRLDVKIKIERPDAESAQDIFSKYLVETLPVHSDDLAEFGGDRTACIR
FT                   VMIERVVDRMYAESEENRFLEVTYANGDKEVLYFKDFNSGAMIQNIVDRAKKYAIKSVL
FT                   DTGAPGLRVQHLFDSIVDEFSENEDLPNTTNPDDWARISGKKGERIVYIRTLVTGKNAS
FT                   ASRAIDTESNTGQYL"
     MSSTENPDSV AAARELEALR AEASALRRQL AESPEQLREM ESRVDSLSIR NTKLMDTLKE        60
     ARQQLIALRE EVDRLGQPPS GYGVLLGVHD DQTVDVFTSG RKMRLTCSPN VDAETLKLGQ       120
     TVRLNEALTI VEAGNFERVG EISTLREVLD DGQRALVVGH ADEERIVWLA EPLATVFEES       180
     ERESVAYDAE SPTRKLRPGD SLLVDTKAGY AFERIPKAEV EDLVLEEVPD VHYDDIGGLG       240
     RQIEQIRDAV ELPFLHKDLF HEYELRPPKG VLLYGPPGCG KTLIAKAVAN SLAKKIAEAR       300
     GQDSKEAKSY FLNIKGPELL NKFVGETERH IRLIFQRARE KASEGTPVIV FFDEMDSIFR       360
     TRGSGVSSDV ETTVVPQLLS EIDGVEGLEN VIVIGASNRE DMIDPAILRP GRLDVKIKIE       420
     RPDAESAQDI FSKYLVETLP VHSDDLAEFG GDRTACIRVM IERVVDRMYA ESEENRFLEV       480
     TYANGDKEVL YFKDFNSGAM IQNIVDRAKK YAIKSVLDTG APGLRVQHLF DSIVDEFSEN       540
     EDLPNTTNPD DWARISGKKG ERIVYIRTLV TGKNASASRA IDTESNTGQY L                591
//

If you have problems or comments...

PBIL Back to PBIL home page