(data stored in ACNUC7421 zone)

EMBL: AP011115.ARGB

AP011115.ARGB        Location/Qualifiers
FT   CDS             complement(715040..715966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="ROP_06850"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="protein synonym:N-acetyl-L-glutamate
FT                   5-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48932"
FT                   /db_xref="GOA:C1AT00"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT00"
FT                   /protein_id="BAH48932.1"
FT                   /translation="MTAASEALTGITDHQKAHVLAEALPWLQQFRDKVVVVKYGGNAMV
FT                   DDALKTAFAADMAFLRTVGIQPVVVHGGGPQINAMLGKLGMTGEFKGGFRVTTPEVMDV
FT                   VRMVLFGQVGRELVGLINAHGPYAVGISGEDAHLFTATKRTVMVEGTPTDIGLVGDVTT
FT                   VNPEAVLDLIRAGRIPVVSTIAPDSDGVVHNINADTAAAALAEAIGAEKLVVLTDVEGL
FT                   YTNWPDRDSLATEIDVDALAQLLPSLDAGMVPKMEACLRAVRGGVPTAHVIDGRLAHSV
FT                   LLELFTGEGIGTMVTPAPTSPTEGVAP"
     MTAASEALTG ITDHQKAHVL AEALPWLQQF RDKVVVVKYG GNAMVDDALK TAFAADMAFL        60
     RTVGIQPVVV HGGGPQINAM LGKLGMTGEF KGGFRVTTPE VMDVVRMVLF GQVGRELVGL       120
     INAHGPYAVG ISGEDAHLFT ATKRTVMVEG TPTDIGLVGD VTTVNPEAVL DLIRAGRIPV       180
     VSTIAPDSDG VVHNINADTA AAALAEAIGA EKLVVLTDVE GLYTNWPDRD SLATEIDVDA       240
     LAQLLPSLDA GMVPKMEACL RAVRGGVPTA HVIDGRLAHS VLLELFTGEG IGTMVTPAPT       300
     SPTEGVAP                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page