(data stored in ACNUC7421 zone)

EMBL: AP011115.ARGC

AP011115.ARGC        Location/Qualifiers
FT   CDS             complement(717204..718259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="ROP_06870"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="protein synonym:N-acetyl-glutamate semialdehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48934"
FT                   /db_xref="GOA:C1AT02"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT02"
FT                   /protein_id="BAH48934.1"
FT                   /translation="MTEHAGKPIRIAVAGASGYAGGEVLRLLLGHPSYADGSLVIGALT
FT                   AGGNAGSTLGSHHPHLLPLADRVLEDTTVDTLSGHDVVFLGLPHGNSAQYAKDLPESTV
FT                   IIDCGADFRLTNAEDWERYYKSPHAGSWPYGLPELPGAREKLAGATRIAVPGCFPTVSS
FT                   LAMAPAVAAGVVEPRVTIVAVTGASGAGRAPKADLLGSEVMGSVRAYGVGGVHRHTPEI
FT                   IQNLSELAGERVTVSFTPVLAPMPRGILATCTAVTTATEDEVRAIYEKAYADEPFVHVL
FT                   PRGVLPQTGAVVGSNAVQIAVAVDADAGQIVVVAVIDNLAKGTAGGAVQSMNLALGLPE
FT                   TAGLSTVGVAP"
     MTEHAGKPIR IAVAGASGYA GGEVLRLLLG HPSYADGSLV IGALTAGGNA GSTLGSHHPH        60
     LLPLADRVLE DTTVDTLSGH DVVFLGLPHG NSAQYAKDLP ESTVIIDCGA DFRLTNAEDW       120
     ERYYKSPHAG SWPYGLPELP GAREKLAGAT RIAVPGCFPT VSSLAMAPAV AAGVVEPRVT       180
     IVAVTGASGA GRAPKADLLG SEVMGSVRAY GVGGVHRHTP EIIQNLSELA GERVTVSFTP       240
     VLAPMPRGIL ATCTAVTTAT EDEVRAIYEK AYADEPFVHV LPRGVLPQTG AVVGSNAVQI       300
     AVAVDADAGQ IVVVAVIDNL AKGTAGGAVQ SMNLALGLPE TAGLSTVGVA P                351
//

If you have problems or comments...

PBIL Back to PBIL home page