(data stored in ACNUC7421 zone)

EMBL: AP011115.ARGG

AP011115.ARGG        Location/Qualifiers
FT   CDS             complement(711120..712319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="ROP_06810"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="protein synonym:citrulline--aspartate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48928"
FT                   /db_xref="GOA:C1ASZ6"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASZ6"
FT                   /protein_id="BAH48928.1"
FT                   /translation="MADRVVLAYSGGLDTSVAISWIGKETGKEVVAVAIDLGQGGEDME
FT                   VVRQRALDCGAVESVVVDARDEFADEYCLPTIQANALYMDRYPLVSAISRPLIVKHLVE
FT                   AARAHGGTTVAHGCTGKGNDQVRFEVGFGSLAPDLDVIAPVRDYAWTREKAIAFAEENE
FT                   IPINVSKKSPFSIDQNVWGRAVETGFLEDLWNAPTKDVYDYTQDPTVNWQAPDELIISF
FT                   EAGRPVAIDGKPVSVLEAIQELNRRAGAQGVGRLDVVEDRLVGIKSREIYEAPGAMVLI
FT                   NAHQELEHVTQERELGRYKRQTEQRWSELVYDGLWFSPLKVALDTFIEKTQERVSGDIR
FT                   LVLHGGAIIVNGRRSNESLYDFNLATYDEGDTFDQSYAKGFVQIHGLSSKVAAKRDLGL
FT                   "
     MADRVVLAYS GGLDTSVAIS WIGKETGKEV VAVAIDLGQG GEDMEVVRQR ALDCGAVESV        60
     VVDARDEFAD EYCLPTIQAN ALYMDRYPLV SAISRPLIVK HLVEAARAHG GTTVAHGCTG       120
     KGNDQVRFEV GFGSLAPDLD VIAPVRDYAW TREKAIAFAE ENEIPINVSK KSPFSIDQNV       180
     WGRAVETGFL EDLWNAPTKD VYDYTQDPTV NWQAPDELII SFEAGRPVAI DGKPVSVLEA       240
     IQELNRRAGA QGVGRLDVVE DRLVGIKSRE IYEAPGAMVL INAHQELEHV TQERELGRYK       300
     RQTEQRWSEL VYDGLWFSPL KVALDTFIEK TQERVSGDIR LVLHGGAIIV NGRRSNESLY       360
     DFNLATYDEG DTFDQSYAKG FVQIHGLSSK VAAKRDLGL                              399
//

If you have problems or comments...

PBIL Back to PBIL home page