(data stored in ACNUC7421 zone)

EMBL: AP011115.ARGH

AP011115.ARGH        Location/Qualifiers
FT   CDS             complement(709699..711117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="ROP_06800"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="protein synonym:arginosuccinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48927"
FT                   /db_xref="GOA:C1ASZ5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASZ5"
FT                   /protein_id="BAH48927.1"
FT                   /translation="MSAHGTNEGALWGGRFESGPAAAMAALSKSTHFDWVLAPYDVRAS
FT                   QAHARVLHKAGLLGDEDLATMLDGLGRLAADVASGDFIPSESDEDVHGALERGLIDRVG
FT                   PDVGGRLRAGRSRNDQVATLFRMWLRDAVRRVAEGVLDIVDALATQAAAHPSAVMPGKT
FT                   HLQAAQPVLLAHHLLAHTHPLLRDVQRLRDFDVRAAVSPYGSGALAGSSLGLDPEAIAA
FT                   ELAFDSSAENSIDATSSRDFAAEAAFVLAMIGVDLSRMAEEVILWSTPEFGYITLADAW
FT                   STGSSIMPQKKNPDVSELTRGKSGRLIGNLTGLLATLKAQPLAYNRDLQEDKEPVFDSV
FT                   AQLELLLPAITGLVATLEFHTDRMAELAPAGFTLATDIAEWLVRQGVPFRVAHEAAGAC
FT                   VRVAEARGAGLEDLTDEELAGVDPALTPDVREVLTVEGSIASRNARGGTAGIRVAEQLG
FT                   GVRQLSESLREWCR"
     MSAHGTNEGA LWGGRFESGP AAAMAALSKS THFDWVLAPY DVRASQAHAR VLHKAGLLGD        60
     EDLATMLDGL GRLAADVASG DFIPSESDED VHGALERGLI DRVGPDVGGR LRAGRSRNDQ       120
     VATLFRMWLR DAVRRVAEGV LDIVDALATQ AAAHPSAVMP GKTHLQAAQP VLLAHHLLAH       180
     THPLLRDVQR LRDFDVRAAV SPYGSGALAG SSLGLDPEAI AAELAFDSSA ENSIDATSSR       240
     DFAAEAAFVL AMIGVDLSRM AEEVILWSTP EFGYITLADA WSTGSSIMPQ KKNPDVSELT       300
     RGKSGRLIGN LTGLLATLKA QPLAYNRDLQ EDKEPVFDSV AQLELLLPAI TGLVATLEFH       360
     TDRMAELAPA GFTLATDIAE WLVRQGVPFR VAHEAAGACV RVAEARGAGL EDLTDEELAG       420
     VDPALTPDVR EVLTVEGSIA SRNARGGTAG IRVAEQLGGV RQLSESLREW CR               472
//

If you have problems or comments...

PBIL Back to PBIL home page