(data stored in ACNUC7421 zone)

EMBL: AP011115.ARGJ

AP011115.ARGJ        Location/Qualifiers
FT   CDS             complement(715963..717207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="ROP_06860"
FT                   /product="glutamate N-acetyltransferase/amino-acid
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:arginine biosynthesis bifunctional
FT                   protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48933"
FT                   /db_xref="GOA:C1AT01"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT01"
FT                   /protein_id="BAH48933.1"
FT                   /translation="MSSDSTIDPHPAREVAGGTLVRSQGVSGPAGFRASGIKAGIKASG
FT                   NADLALVVNEGPELAAAGVFTANKVKAAPVLWSQQVLTTGRLRAVVLNSGGANACTGAG
FT                   GFQDAHKTAEEVASALSNWGTETGAVEVAVCSTGLIGDRLPMDKVLTGVTEAVHELAGG
FT                   ISGGTDAAYAIMTTDTVPKQAALHHAGKWNVGGMAKGAGMLAPALATMLCVVTTDAVAT
FT                   ASQLDAALRAATRVTFDRLDVDGATSTNDTVLLLASGASNVTPTQEELNAAVTAVCDDL
FT                   ADQMMADAEGVTKRVRVTVSGAVSEHDALIGARTVARDSLVKTALFGSDPNWGRVLAAI
FT                   GIAPIELDPDKISVSFNGAPVCIDGVGAPGARDVDLSEVDIALDIDLGLGEHAVTIRTT
FT                   DLSHAYVEENSAYSS"
     MSSDSTIDPH PAREVAGGTL VRSQGVSGPA GFRASGIKAG IKASGNADLA LVVNEGPELA        60
     AAGVFTANKV KAAPVLWSQQ VLTTGRLRAV VLNSGGANAC TGAGGFQDAH KTAEEVASAL       120
     SNWGTETGAV EVAVCSTGLI GDRLPMDKVL TGVTEAVHEL AGGISGGTDA AYAIMTTDTV       180
     PKQAALHHAG KWNVGGMAKG AGMLAPALAT MLCVVTTDAV ATASQLDAAL RAATRVTFDR       240
     LDVDGATSTN DTVLLLASGA SNVTPTQEEL NAAVTAVCDD LADQMMADAE GVTKRVRVTV       300
     SGAVSEHDAL IGARTVARDS LVKTALFGSD PNWGRVLAAI GIAPIELDPD KISVSFNGAP       360
     VCIDGVGAPG ARDVDLSEVD IALDIDLGLG EHAVTIRTTD LSHAYVEENS AYSS             414
//

If you have problems or comments...

PBIL Back to PBIL home page