(data stored in ACNUC7421 zone)

EMBL: AP011115.CMK

AP011115.CMK         Location/Qualifiers
FT   CDS             complement(681157..681846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="ROP_06580"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="protein synonym:CMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48905"
FT                   /db_xref="GOA:C1ASX3"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASX3"
FT                   /protein_id="BAH48905.1"
FT                   /translation="MSTSSLIVAMDGPSGTGKSSVSRMLARRLGARYLDTGAMYRIATL
FT                   HVLRKGVDLADPDAIADATVGLPWSIGTDPAGEQVLLDGEDVGEEIRGDAVTKAVSAVS
FT                   AVPAVRELLVAAQRRLACEAGRIVVEGRDIGTVVLPDADVKIYLTASAEARAQRRNAQN
FT                   LAEGRGDDFAAVLADVQRRDHLDSTRAVSPLRPADDSVLVDTSELGIDDVIGRLLLVVS
FT                   ERSGVGQ"
     MSTSSLIVAM DGPSGTGKSS VSRMLARRLG ARYLDTGAMY RIATLHVLRK GVDLADPDAI        60
     ADATVGLPWS IGTDPAGEQV LLDGEDVGEE IRGDAVTKAV SAVSAVPAVR ELLVAAQRRL       120
     ACEAGRIVVE GRDIGTVVLP DADVKIYLTA SAEARAQRRN AQNLAEGRGD DFAAVLADVQ       180
     RRDHLDSTRA VSPLRPADDS VLVDTSELGI DDVIGRLLLV VSERSGVGQ                   229
//

If you have problems or comments...

PBIL Back to PBIL home page