(data stored in ACNUC7421 zone)

EMBL: AP011115.COAE

AP011115.COAE        Location/Qualifiers
FT   CDS             complement(739311..740525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="ROP_07070"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="protein synonym:dephosphocoenzyme A kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48954"
FT                   /db_xref="GOA:C1AT22"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT22"
FT                   /protein_id="BAH48954.1"
FT                   /translation="MLRIGLTGGIGAGKSTVSKVLAELGAVIVDADLIAREVVEPGTQG
FT                   LAALVDRFGEEILTADGALDRPALAARAFADEESRLALNSIVHPLVGARTTETIESAPE
FT                   DAVLVQDIPLLVEGGMGAAFHLVVVVFVDAEDRVRRLVGSRGMSESDARARIAAQADDD
FT                   QRRAAADVRLDNSGAPGALEPEVRALWAERLVPFESNIRTRTVVRVLPELASPNPQWPA
FT                   QADRLIARLRLVCGDRAVRIDHIGSTAVEGLPAKDVIDVQVTVANLEVADELAESLAAA
FT                   GFPRIEHITADDPKPAYQGGETDPALWGKRIHGGADPGRPVNIHLRVDGWPGQQFALVF
FT                   RDWLRADTDARAEYLAVKEAAAEKAAGHADYQDAITAYVDAKTPWFDRAYHRAWQWAEQ
FT                   TGWSA"
     MLRIGLTGGI GAGKSTVSKV LAELGAVIVD ADLIAREVVE PGTQGLAALV DRFGEEILTA        60
     DGALDRPALA ARAFADEESR LALNSIVHPL VGARTTETIE SAPEDAVLVQ DIPLLVEGGM       120
     GAAFHLVVVV FVDAEDRVRR LVGSRGMSES DARARIAAQA DDDQRRAAAD VRLDNSGAPG       180
     ALEPEVRALW AERLVPFESN IRTRTVVRVL PELASPNPQW PAQADRLIAR LRLVCGDRAV       240
     RIDHIGSTAV EGLPAKDVID VQVTVANLEV ADELAESLAA AGFPRIEHIT ADDPKPAYQG       300
     GETDPALWGK RIHGGADPGR PVNIHLRVDG WPGQQFALVF RDWLRADTDA RAEYLAVKEA       360
     AAEKAAGHAD YQDAITAYVD AKTPWFDRAY HRAWQWAEQT GWSA                        404
//

If you have problems or comments...

PBIL Back to PBIL home page