(data stored in ACNUC7421 zone)

EMBL: AP011115.COBH

AP011115.COBH        Location/Qualifiers
FT   CDS             313626..314252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /locus_tag="ROP_02930"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.99.61"
FT                   /note="protein synonym:precorrin isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48540"
FT                   /db_xref="GOA:C1AR63"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR63"
FT                   /protein_id="BAH48540.1"
FT                   /translation="MIEYIRDGAEIYRQSFATIRAEADLSAFPEDVSQAVVRMIHASGQ
FT                   VDLVDDVAFTPGVVKAARAALADGAPILCDAQMVAAGVTRKRLPADNEVICTLRDPRVP
FT                   VLAEQIGNTRSAAALELWGGKLEGAVVAIGNAPTALFYLLDMIESGAPRPAAIVGGPVG
FT                   FIGAAESKEALIEHPSGLDYLVVRGRRGGSAITAAALNAIASEVE"
     MIEYIRDGAE IYRQSFATIR AEADLSAFPE DVSQAVVRMI HASGQVDLVD DVAFTPGVVK        60
     AARAALADGA PILCDAQMVA AGVTRKRLPA DNEVICTLRD PRVPVLAEQI GNTRSAAALE       120
     LWGGKLEGAV VAIGNAPTAL FYLLDMIESG APRPAAIVGG PVGFIGAAES KEALIEHPSG       180
     LDYLVVRGRR GGSAITAAAL NAIASEVE                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page