(data stored in ACNUC7421 zone)

EMBL: AP011115.COBIJ

AP011115.COBIJ       Location/Qualifiers
FT   CDS             314249..315751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobIJ"
FT                   /locus_tag="ROP_02940"
FT                   /product="precorrin-2 C(20)-methyltransferase/precorrin-3B
FT                   C(17)-methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /EC_number="2.1.1.131"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:cobalamin biosynthesis protein
FT                   CobIJ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48541"
FT                   /db_xref="GOA:C1AR64"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR64"
FT                   /protein_id="BAH48541.1"
FT                   /translation="MSSEERSTGKLWGVGIGPGDPELVTVKAARIITEADVVAFHSARH
FT                   GKSISRAVAAPYLRDGQIEEHLVYPVTTETVDHPGGYQGAMDEFYEEASQRLAAHLEAG
FT                   RSVALLAAGDPLFYSSYMHMHKRLAQRFEAEVIPGVTSISAASAALAMPLVEGEEILTV
FT                   LPGTLPRGELTRRLRETDAAAILKLGRTYPAVRQALKDSGRIDETWYVERASTTRQKID
FT                   HADDVSDSDVPYFSIAIVPSPSNARREDAPPQGELVVVGLGPGDQSWTTPEVQHELSLA
FT                   TDLVGYGPYIDRVPERPGQRRHSSDNRVEAERAAMALDLAKNGARVAVVSSGDPGVFAM
FT                   AAAVLEVAAEEQWRGVPVRVLPGMTAANAVASRVGAPLGHDYAVLSLSDRLKPWDVVAQ
FT                   RISAVASADMAFAVYNPASKSRTWQVAAMRDLVLEHRSPDTPVIIGRDVAGPQESVRVV
FT                   RLADLDPAEIDMRCLLIVGSSMTTVVENEHGTRVFTPRRYPG"
     MSSEERSTGK LWGVGIGPGD PELVTVKAAR IITEADVVAF HSARHGKSIS RAVAAPYLRD        60
     GQIEEHLVYP VTTETVDHPG GYQGAMDEFY EEASQRLAAH LEAGRSVALL AAGDPLFYSS       120
     YMHMHKRLAQ RFEAEVIPGV TSISAASAAL AMPLVEGEEI LTVLPGTLPR GELTRRLRET       180
     DAAAILKLGR TYPAVRQALK DSGRIDETWY VERASTTRQK IDHADDVSDS DVPYFSIAIV       240
     PSPSNARRED APPQGELVVV GLGPGDQSWT TPEVQHELSL ATDLVGYGPY IDRVPERPGQ       300
     RRHSSDNRVE AERAAMALDL AKNGARVAVV SSGDPGVFAM AAAVLEVAAE EQWRGVPVRV       360
     LPGMTAANAV ASRVGAPLGH DYAVLSLSDR LKPWDVVAQR ISAVASADMA FAVYNPASKS       420
     RTWQVAAMRD LVLEHRSPDT PVIIGRDVAG PQESVRVVRL ADLDPAEIDM RCLLIVGSSM       480
     TTVVENEHGT RVFTPRRYPG                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page