(data stored in ACNUC7421 zone)

EMBL: AP011115.COBK

AP011115.COBK        Location/Qualifiers
FT   CDS             complement(582605..583345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobK"
FT                   /locus_tag="ROP_05640"
FT                   /product="precorrin-6X reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="protein synonym:precorrin-6A reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48811"
FT                   /db_xref="GOA:C1ARY4"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY4"
FT                   /protein_id="BAH48811.1"
FT                   /translation="MSRILILGGTGEARALAAALADVPGVEAVSSLAGRVRDPRLPAGE
FT                   VRIGGFGGAAGLAEWLCAHPVDAIVDATHPFAAQITRNAADAAHRRGIPLVVLRRPEWA
FT                   PRPGEHWHTAPDLARAADLLPGLGTRIFLTIGRQGVDVFAGLHALWFLIRAIDPPDVAM
FT                   PPQSTLLLARGPFAVAGETALMREHRIDVLVTKNSGGGQTDAKLDAARALGIPVLMIRR
FT                   PPLPSATATVDDVAGAVAWIGALA"
     MSRILILGGT GEARALAAAL ADVPGVEAVS SLAGRVRDPR LPAGEVRIGG FGGAAGLAEW        60
     LCAHPVDAIV DATHPFAAQI TRNAADAAHR RGIPLVVLRR PEWAPRPGEH WHTAPDLARA       120
     ADLLPGLGTR IFLTIGRQGV DVFAGLHALW FLIRAIDPPD VAMPPQSTLL LARGPFAVAG       180
     ETALMREHRI DVLVTKNSGG GQTDAKLDAA RALGIPVLMI RRPPLPSATA TVDDVAGAVA       240
     WIGALA                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page