(data stored in ACNUC7421 zone)

EMBL: AP011115.COBL

AP011115.COBL        Location/Qualifiers
FT   CDS             complement(584094..585329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobL"
FT                   /locus_tag="ROP_05660"
FT                   /product="precorrin-6Y C5,15-methyltransferase"
FT                   /EC_number="2.1.1.132"
FT                   /note="protein synonym:precorrin-6Y methylase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48813"
FT                   /db_xref="GOA:C1ARY6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY6"
FT                   /protein_id="BAH48813.1"
FT                   /translation="MTDPIVVVGIGADGWDGLSPSARREIEVADVVMGSGRQLALIPET
FT                   PALRVAWPSPLVPALPGLFEQHHGRRVCVLASGDPMFHGIGVTLVNLLGAERVRVIPHP
FT                   SSATLACARLGWAAHETPVISLVNRPVDALLPELADATRLLVLSRDEHTPAAVADLLTG
FT                   RGFGPSRLTVLGELGGPDESRLDGTASVWSHGPGPRLNVIAIDCRAESGAVRLTRLPGL
FT                   PDAAFTGDGQMTKHEIRALTLCALAPAAGELLWDVGGGSGTVAIEWMRTHPRCRAVTFE
FT                   RSAARVDQIEANASALGVPSLTVFGDAPAAFEDVPPASSVPDAIFVGGGVTQDGLLGEC
FT                   WSRLRVGGRMVANAVTAESEALLLQWFSKCGGQLRKFQVYRGEPLGGFTAWRPQLPVAQ
FT                   WSVTKQSKGDAA"
     MTDPIVVVGI GADGWDGLSP SARREIEVAD VVMGSGRQLA LIPETPALRV AWPSPLVPAL        60
     PGLFEQHHGR RVCVLASGDP MFHGIGVTLV NLLGAERVRV IPHPSSATLA CARLGWAAHE       120
     TPVISLVNRP VDALLPELAD ATRLLVLSRD EHTPAAVADL LTGRGFGPSR LTVLGELGGP       180
     DESRLDGTAS VWSHGPGPRL NVIAIDCRAE SGAVRLTRLP GLPDAAFTGD GQMTKHEIRA       240
     LTLCALAPAA GELLWDVGGG SGTVAIEWMR THPRCRAVTF ERSAARVDQI EANASALGVP       300
     SLTVFGDAPA AFEDVPPASS VPDAIFVGGG VTQDGLLGEC WSRLRVGGRM VANAVTAESE       360
     ALLLQWFSKC GGQLRKFQVY RGEPLGGFTA WRPQLPVAQW SVTKQSKGDA A                411
//

If you have problems or comments...

PBIL Back to PBIL home page