(data stored in ACNUC7421 zone)

EMBL: AP011115.COBN

AP011115.COBN        Location/Qualifiers
FT   CDS             complement(308660..312262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobN"
FT                   /locus_tag="ROP_02910"
FT                   /product="cobaltochelatase CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="protein synonym:cobalamin biosynthesis protein"
FT                   /note="protein synonym:hydrogenobyrinic acid a,c-diamide
FT                   cobaltochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48538"
FT                   /db_xref="GOA:C1AR61"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR61"
FT                   /protein_id="BAH48538.1"
FT                   /translation="MILLLSTSDTDLLSARASGADYRWANPARLLVEEDLPGLLDGADL
FT                   VVVRILGGKRAWEEGLDAVLASGLPVVVLGGEHAPDAELMECSTVAAGVSAEAHNYLAE
FT                   GGADNLAQLHHFLSDTVLLTGHGFEAPVHLPSWGVAPFAPDADAGRPTIAVLYYRAQHL
FT                   AGNTRYIEALCDAVEAAGGTPLPIFCASLRTAEPELLTTLRRADAMVVTVLAAGGTKPA
FT                   GVSAGGDDEAWDVAALAALDVPILQGLCLTSSRESWEANDDGLSPLDVATQVAVPEFDG
FT                   RLITVPFSFKEIDADGLSTYVPDAERASRVAGIAVRHARLRHIPAAERRIALMLSAYPT
FT                   KHARIGNAVGLDTPASAIRLLTEMRAAGYDLGPADGPDSVPGLAARDGDALIHALIAAG
FT                   GQDPDWLTAEQLEGNPIRISAARYREWFSALPAELREGVEEHWGPAPGELYVDRSQDPA
FT                   GEIVIAAMQFGNLVLMVQPPRGFGEKPVAIYHDPDLPPSHHYLAAYRWIAADAAAGGFG
FT                   ADAVVHLGKHGNLEWLPGKTLGMSASCGTDAALGDLPLIYPFLVNDPGEGTQAKRRAHA
FT                   TLVDHLIPPMARAESYGDISRLEQLLDEHSNISALDPSKLPAIRQQIWTLMRAAKMDHD
FT                   LGLEERPEEDVFDDMLLHVDGWLCEIKDVQIRDGLHVLGEAPRDDAEVELVLAMLRARQ
FT                   MWGGEQNVPGLREALGLSEDGDESRTRVDEIEQQAHALVQGMHDADWNPDAADTLTADA
FT                   TVAKILRFAATEVVPRLRETDNEIAQVLHALDGGFIAAGPSGSPLRGLINVLPTGRNFY
FT                   SVDPKAVPSRLAWETGQAMAESLLDRYKSDHGEWPRSVGLSVWGTSAMRTSGDDIAEVF
FT                   ALLGVRPVWDEASRRVVNLEVIDLEELGRPRIDVTVRISGFFRDAFPHVLALLDDAVRL
FT                   VAAVDEPAESNFVRAHAQADLAEHGDERRATTRIFGSKPGTYGAGLLQLIDSKSWRGDA
FT                   DLADVYTTWGGFAYGRGLDGAPAADDMRTAYRRITVAAKNTDTREHDIADADDYFQYHG
FT                   GMVATVRALTGKSPEAYIGDSTRPESVRTRTLSEETSRVFRARVVNPRWLEAMRRHGYK
FT                   GAFEMAATVDYLFGYDATTNVVADWMYEKLAESYVLDEQNRKFMEQSNPWALHGIAERL
FT                   LEAAERDMWEHPEQQTLDGLRQVYLETEGELEGD"
     MILLLSTSDT DLLSARASGA DYRWANPARL LVEEDLPGLL DGADLVVVRI LGGKRAWEEG        60
     LDAVLASGLP VVVLGGEHAP DAELMECSTV AAGVSAEAHN YLAEGGADNL AQLHHFLSDT       120
     VLLTGHGFEA PVHLPSWGVA PFAPDADAGR PTIAVLYYRA QHLAGNTRYI EALCDAVEAA       180
     GGTPLPIFCA SLRTAEPELL TTLRRADAMV VTVLAAGGTK PAGVSAGGDD EAWDVAALAA       240
     LDVPILQGLC LTSSRESWEA NDDGLSPLDV ATQVAVPEFD GRLITVPFSF KEIDADGLST       300
     YVPDAERASR VAGIAVRHAR LRHIPAAERR IALMLSAYPT KHARIGNAVG LDTPASAIRL       360
     LTEMRAAGYD LGPADGPDSV PGLAARDGDA LIHALIAAGG QDPDWLTAEQ LEGNPIRISA       420
     ARYREWFSAL PAELREGVEE HWGPAPGELY VDRSQDPAGE IVIAAMQFGN LVLMVQPPRG       480
     FGEKPVAIYH DPDLPPSHHY LAAYRWIAAD AAAGGFGADA VVHLGKHGNL EWLPGKTLGM       540
     SASCGTDAAL GDLPLIYPFL VNDPGEGTQA KRRAHATLVD HLIPPMARAE SYGDISRLEQ       600
     LLDEHSNISA LDPSKLPAIR QQIWTLMRAA KMDHDLGLEE RPEEDVFDDM LLHVDGWLCE       660
     IKDVQIRDGL HVLGEAPRDD AEVELVLAML RARQMWGGEQ NVPGLREALG LSEDGDESRT       720
     RVDEIEQQAH ALVQGMHDAD WNPDAADTLT ADATVAKILR FAATEVVPRL RETDNEIAQV       780
     LHALDGGFIA AGPSGSPLRG LINVLPTGRN FYSVDPKAVP SRLAWETGQA MAESLLDRYK       840
     SDHGEWPRSV GLSVWGTSAM RTSGDDIAEV FALLGVRPVW DEASRRVVNL EVIDLEELGR       900
     PRIDVTVRIS GFFRDAFPHV LALLDDAVRL VAAVDEPAES NFVRAHAQAD LAEHGDERRA       960
     TTRIFGSKPG TYGAGLLQLI DSKSWRGDAD LADVYTTWGG FAYGRGLDGA PAADDMRTAY      1020
     RRITVAAKNT DTREHDIADA DDYFQYHGGM VATVRALTGK SPEAYIGDST RPESVRTRTL      1080
     SEETSRVFRA RVVNPRWLEA MRRHGYKGAF EMAATVDYLF GYDATTNVVA DWMYEKLAES      1140
     YVLDEQNRKF MEQSNPWALH GIAERLLEAA ERDMWEHPEQ QTLDGLRQVY LETEGELEGD      1200
//

If you have problems or comments...

PBIL Back to PBIL home page