(data stored in ACNUC7421 zone)

EMBL: AP011115.CTAD

AP011115.CTAD        Location/Qualifiers
FT   CDS             72880..74625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaD"
FT                   /locus_tag="ROP_00830"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48330"
FT                   /db_xref="GOA:C1AS81"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS81"
FT                   /protein_id="BAH48330.1"
FT                   /translation="MTPLTVEVVPVRPFPARRGIKGSFLYKAATTTDPKMLGLMYMVTS
FT                   FVFFMVGGLMALLIRTELAVPGLQFLSNEQYNQLFTMHGTIMLLLYATPIVFGFANYIL
FT                   PLQIGAPDVAFPRLNALSYWLYLFGAIITVSGFLTPGGAADFGWTGYSPLTSAVHSPGV
FT                   GADVWITGLALAGVGTILGGVNMITTVICLRAPGMTMFRMPIFTWNIFITMILVLIAFP
FT                   ILAAALLGLLVDRHLGAHLFDPATGGALLWQHLFWFFGHPEVYIVAIPFFGIVSEIFPV
FT                   FSRKPLFGYTGLVYATIAIAALSTAVWAHHMFATGAVLLPFFSLMSFFIAVPTGVKFFN
FT                   WIGTMWKGQLTFETPMLFSIGFLVTFLFGGLSGVLLASPPLDFHVTDSYFLVAHFHYVL
FT                   FGTIVFATYAGIYFWFPKMTGRLMDERLGRWHFWTTFIGFHTTFLVQHWLGAEGMPRRY
FT                   ADYLPSDGFTTLNTVSTIGSFVLGGSVLPFVWNVFKSYRYGQVVTVDDPWGYGNSLEWA
FT                   TSCPPPRHNFTELPRIRSERPAFELHYPHMVKRMRAETYVGRRPKSVAVTAGTVSGPER
FT                   EAGRR"
     MTPLTVEVVP VRPFPARRGI KGSFLYKAAT TTDPKMLGLM YMVTSFVFFM VGGLMALLIR        60
     TELAVPGLQF LSNEQYNQLF TMHGTIMLLL YATPIVFGFA NYILPLQIGA PDVAFPRLNA       120
     LSYWLYLFGA IITVSGFLTP GGAADFGWTG YSPLTSAVHS PGVGADVWIT GLALAGVGTI       180
     LGGVNMITTV ICLRAPGMTM FRMPIFTWNI FITMILVLIA FPILAAALLG LLVDRHLGAH       240
     LFDPATGGAL LWQHLFWFFG HPEVYIVAIP FFGIVSEIFP VFSRKPLFGY TGLVYATIAI       300
     AALSTAVWAH HMFATGAVLL PFFSLMSFFI AVPTGVKFFN WIGTMWKGQL TFETPMLFSI       360
     GFLVTFLFGG LSGVLLASPP LDFHVTDSYF LVAHFHYVLF GTIVFATYAG IYFWFPKMTG       420
     RLMDERLGRW HFWTTFIGFH TTFLVQHWLG AEGMPRRYAD YLPSDGFTTL NTVSTIGSFV       480
     LGGSVLPFVW NVFKSYRYGQ VVTVDDPWGY GNSLEWATSC PPPRHNFTEL PRIRSERPAF       540
     ELHYPHMVKR MRAETYVGRR PKSVAVTAGT VSGPEREAGR R                           581
//

If you have problems or comments...

PBIL Back to PBIL home page