(data stored in ACNUC7421 zone)

EMBL: AP011115.DEVS

AP011115.DEVS        Location/Qualifiers
FT   CDS             168009..169739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="devS"
FT                   /locus_tag="ROP_01930"
FT                   /product="two-component histidine kinase DevS"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48440"
FT                   /db_xref="GOA:C1ASJ1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ1"
FT                   /protein_id="BAH48440.1"
FT                   /translation="MRRVTRLPDERDRGPLLGSLSELRLRELLTEVQDRIAQIVDVRDH
FT                   VDGLLEAMLAVTSGLDLDNTLRTIVHAAIDLVDARYGALGVLAPTEGLSEFVYEGIDQE
FT                   TRERIGDLPRGRGVLGFLITDPKPVRLVDLSRHPVSVGFPPDHPPMKTFLGVPIQVRDE
FT                   VFGNLYLTEKANGAQFTEDDEVLLRALAAAAGIAIENARLYEESRTRQAWLEATREIAT
FT                   ELLAGSETADVLQVIADDALALTAADSAFLAVPDDPDIPSDEVTELVVTASAGTVSDRI
FT                   IGRAIPVERSTSGEAFRERTPLRVSALAFDPGFETGARFGPALALPLRAAQSVSGVLVT
FT                   LRHVDASPFTDDQLALMSGFADQAAVALQLANSQRRMHELDVLSDRDRIARDLHDHVIQ
FT                   RLFAVGLSLQSTLQRAKAPVVKDRLEQSIDDLHDIVRDIRTAIFDLHGGSGGITQFRRR
FT                   LHEIVAETTADSGLRTTVHMSGPLSVIDATLAEHAEAVLREALSNAVRHAGADTVTVSI
FT                   SVYDDLAIEVADDGKGFEGSVLTSGLDNLAARAREVNGHCAVDSTLGGGTTLRWSAPLP
FT                   "
     MRRVTRLPDE RDRGPLLGSL SELRLRELLT EVQDRIAQIV DVRDHVDGLL EAMLAVTSGL        60
     DLDNTLRTIV HAAIDLVDAR YGALGVLAPT EGLSEFVYEG IDQETRERIG DLPRGRGVLG       120
     FLITDPKPVR LVDLSRHPVS VGFPPDHPPM KTFLGVPIQV RDEVFGNLYL TEKANGAQFT       180
     EDDEVLLRAL AAAAGIAIEN ARLYEESRTR QAWLEATREI ATELLAGSET ADVLQVIADD       240
     ALALTAADSA FLAVPDDPDI PSDEVTELVV TASAGTVSDR IIGRAIPVER STSGEAFRER       300
     TPLRVSALAF DPGFETGARF GPALALPLRA AQSVSGVLVT LRHVDASPFT DDQLALMSGF       360
     ADQAAVALQL ANSQRRMHEL DVLSDRDRIA RDLHDHVIQR LFAVGLSLQS TLQRAKAPVV       420
     KDRLEQSIDD LHDIVRDIRT AIFDLHGGSG GITQFRRRLH EIVAETTADS GLRTTVHMSG       480
     PLSVIDATLA EHAEAVLREA LSNAVRHAGA DTVTVSISVY DDLAIEVADD GKGFEGSVLT       540
     SGLDNLAARA REVNGHCAVD STLGGGTTLR WSAPLP                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page