(data stored in ACNUC7421 zone)

EMBL: AP011115.DNAJ

AP011115.DNAJ        Location/Qualifiers
FT   CDS             139725..140915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ROP_01570"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48404"
FT                   /db_xref="GOA:C1ASF5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF5"
FT                   /protein_id="BAH48404.1"
FT                   /translation="MTQQEWIERDFYADLGVPSTASAEQIKRAYRTLARRLHPDANPDD
FT                   AAAGERFKAVSEAHAVLSDPATRAEYDRTRQLYRSGSFRQAGTRAGAAARSGGGMGGFD
FT                   LSDLFGSGSAAFTSGDAGFGDVFGDLFRRSGTRTTTASSRPRRGSDVEAQTRLPLRQAV
FT                   TGVVLPLQVSGPTVCTTCHGSGARPGTRPRRCPSCGGAGTLTRNQGGFGFSEPCDDCRG
FT                   TGMIVDHPCADCQGTGVGHRTRTINVRIPPGVTDGQRIRLPAHGEPGLRGAPAGDLYVT
FT                   VTVDPDPVFGRDGDDLTVTVPVGFGELALGTTISVPTLDGRVSVKIPAGTPSGRTFRLR
FT                   GRGVHRGGGPAGDLRVTVQVAVPTRLDRSAVDALRAYDKAEKATGFDPRAAWPGHR"
     MTQQEWIERD FYADLGVPST ASAEQIKRAY RTLARRLHPD ANPDDAAAGE RFKAVSEAHA        60
     VLSDPATRAE YDRTRQLYRS GSFRQAGTRA GAAARSGGGM GGFDLSDLFG SGSAAFTSGD       120
     AGFGDVFGDL FRRSGTRTTT ASSRPRRGSD VEAQTRLPLR QAVTGVVLPL QVSGPTVCTT       180
     CHGSGARPGT RPRRCPSCGG AGTLTRNQGG FGFSEPCDDC RGTGMIVDHP CADCQGTGVG       240
     HRTRTINVRI PPGVTDGQRI RLPAHGEPGL RGAPAGDLYV TVTVDPDPVF GRDGDDLTVT       300
     VPVGFGELAL GTTISVPTLD GRVSVKIPAG TPSGRTFRLR GRGVHRGGGP AGDLRVTVQV       360
     AVPTRLDRSA VDALRAYDKA EKATGFDPRA AWPGHR                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page