(data stored in ACNUC7421 zone)

EMBL: AP011115.DNAK

AP011115.DNAK        Location/Qualifiers
FT   CDS             136963..138834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="ROP_01550"
FT                   /product="chaperone protein DnaK"
FT                   /note="protein synonym:Hsp70"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48402"
FT                   /db_xref="GOA:C1ASF3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF3"
FT                   /protein_id="BAH48402.1"
FT                   /translation="MARAVGIDLGTTNSVVCVLEGGDPVVVANSEGSRTTPSVVAFAKS
FT                   GEVLVGQPAKNQAVTNVDRTVRSVKREIGTDWTVAIDDKNYTAQEISARVLMKLKRDAE
FT                   SYLGEDITDAVITVPAYFNDAQRQATKEAGQIAGLTVLRIINEPTAAALAYGLDKGGKE
FT                   QTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDDRIVRWLAEKFKASSGF
FT                   DLTKDKMALQRLREAAEKAKIELSSSHSTSINLPYITVDADKNPLFLDEQLSRSEFEKI
FT                   TSDLLGRTRAPFDSVIKDAKISVGDIDHVVLVGGSTRMPAVTNLVRELTGGKEPNKGVN
FT                   PDEVVAVGAALQAGVLGGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSET
FT                   FTTADDNQPSVQIQVYQGEREIASHNKLLGSFELAGIPPAPRGVPQIEVTFDIDANGIV
FT                   HVTAKDKGTGKENRIRIQEGSALSKEDIDRMIRDAEAHAAEDSRRREEAETRNQAESLV
FT                   YQTEKFIKDNDNKVPADVTDKVRSAIAQVQDALAGTDIAAIKTAMEKLGTESQALGQAI
FT                   YAAQAQQDGASAGGDGGPGAGAGASGDGHGADDVVDAEVVDEPREGR"
     MARAVGIDLG TTNSVVCVLE GGDPVVVANS EGSRTTPSVV AFAKSGEVLV GQPAKNQAVT        60
     NVDRTVRSVK REIGTDWTVA IDDKNYTAQE ISARVLMKLK RDAESYLGED ITDAVITVPA       120
     YFNDAQRQAT KEAGQIAGLT VLRIINEPTA AALAYGLDKG GKEQTILVFD LGGGTFDVSL       180
     LEIGEGVVEV RATSGDNHLG GDDWDDRIVR WLAEKFKASS GFDLTKDKMA LQRLREAAEK       240
     AKIELSSSHS TSINLPYITV DADKNPLFLD EQLSRSEFEK ITSDLLGRTR APFDSVIKDA       300
     KISVGDIDHV VLVGGSTRMP AVTNLVRELT GGKEPNKGVN PDEVVAVGAA LQAGVLGGEV       360
     KDVLLLDVTP LSLGIETKGG VMTKLIERNT TIPTKRSETF TTADDNQPSV QIQVYQGERE       420
     IASHNKLLGS FELAGIPPAP RGVPQIEVTF DIDANGIVHV TAKDKGTGKE NRIRIQEGSA       480
     LSKEDIDRMI RDAEAHAAED SRRREEAETR NQAESLVYQT EKFIKDNDNK VPADVTDKVR       540
     SAIAQVQDAL AGTDIAAIKT AMEKLGTESQ ALGQAIYAAQ AQQDGASAGG DGGPGAGAGA       600
     SGDGHGADDV VDAEVVDEPR EGR                                               623
//

If you have problems or comments...

PBIL Back to PBIL home page