(data stored in ACNUC7421 zone)

EMBL: AP011115.DPS

AP011115.DPS         Location/Qualifiers
FT   CDS             190514..191053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dps"
FT                   /locus_tag="ROP_02190"
FT                   /product="DNA-binding protein Dps"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48466"
FT                   /db_xref="GOA:C1ASL7"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL7"
FT                   /protein_id="BAH48466.1"
FT                   /translation="MSKFTVPGLSDDQGARVADILQKRLSAYNDLHLTLKHIHWNVVGP
FT                   NFIGVHEMIDPQVELVRGYADAVAERIAALGKSPDGTPAAITRDRTWDDYSVNRDTAQA
FT                   HLGALDLVYSGVVEDNRKAIAETGDLDPITEDLLIGQTGELEKFQWFVRAHLENSGGGL
FT                   STNGANTEKQAASQAR"
     MSKFTVPGLS DDQGARVADI LQKRLSAYND LHLTLKHIHW NVVGPNFIGV HEMIDPQVEL        60
     VRGYADAVAE RIAALGKSPD GTPAAITRDR TWDDYSVNRD TAQAHLGALD LVYSGVVEDN       120
     RKAIAETGDL DPITEDLLIG QTGELEKFQW FVRAHLENSG GGLSTNGANT EKQAASQAR        179
//

If you have problems or comments...

PBIL Back to PBIL home page