(data stored in ACNUC7421 zone)

EMBL: AP011115.ENGA

AP011115.ENGA        Location/Qualifiers
FT   CDS             complement(679733..681160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="ROP_06570"
FT                   /product="GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48904"
FT                   /db_xref="GOA:C1ASX2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX2"
FT                   /protein_id="BAH48904.1"
FT                   /translation="MTEQFTTEFAGDGTWSEESDWEVLDLEDGGDGEAHVPVPTLAVVG
FT                   RPNVGKSTLVNRIIGRREAVVEDIPGVTRDRVSYEANWSGRRFMVQDTGGWEPDAKGLQ
FT                   QSVARQAELAMQTADAILLVVDAVVGATATDEAVAKVLRRSKTPVLLVANKVDDGRTES
FT                   EVAALWSLGLGQPHSVSATHGRGTGDLLDEVLAALPETPREGIPGGGPRRVALVGKPNV
FT                   GKSSLLNKLSGDERSVVHNVAGTTVDPVDSIVELGGRPWRFVDTAGLRKRVSHASGAEF
FT                   YASLRTKSAIEAAEVAILLIDASEPISEQDLRVLSMVADAGRALVIAFNKWDLVDEDRR
FT                   LQLDREVDRDLVRVPWAQRVNISAQTGRAVQKLVPALDTALESWDKRIPTGRLNTWLKE
FT                   VVAATPPPMRGGRLPRVMFATQAGTRPPTFVLFTTGFLEAGYRRFLERRLREEFNFDGS
FT                   PVRISVRVREKRERRSR"
     MTEQFTTEFA GDGTWSEESD WEVLDLEDGG DGEAHVPVPT LAVVGRPNVG KSTLVNRIIG        60
     RREAVVEDIP GVTRDRVSYE ANWSGRRFMV QDTGGWEPDA KGLQQSVARQ AELAMQTADA       120
     ILLVVDAVVG ATATDEAVAK VLRRSKTPVL LVANKVDDGR TESEVAALWS LGLGQPHSVS       180
     ATHGRGTGDL LDEVLAALPE TPREGIPGGG PRRVALVGKP NVGKSSLLNK LSGDERSVVH       240
     NVAGTTVDPV DSIVELGGRP WRFVDTAGLR KRVSHASGAE FYASLRTKSA IEAAEVAILL       300
     IDASEPISEQ DLRVLSMVAD AGRALVIAFN KWDLVDEDRR LQLDREVDRD LVRVPWAQRV       360
     NISAQTGRAV QKLVPALDTA LESWDKRIPT GRLNTWLKEV VAATPPPMRG GRLPRVMFAT       420
     QAGTRPPTFV LFTTGFLEAG YRRFLERRLR EEFNFDGSPV RISVRVREKR ERRSR            475
//

If you have problems or comments...

PBIL Back to PBIL home page