(data stored in ACNUC7421 zone)

EMBL: AP011115.GCVP

AP011115.GCVP        Location/Qualifiers
FT   CDS             complement(661646..664498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="ROP_06370"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.4.4.2"
FT                   /note="protein synonym:glycine cleavage system P-protein"
FT                   /note="protein synonym:glycine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48884"
FT                   /db_xref="GOA:C1ASV2"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV2"
FT                   /protein_id="BAH48884.1"
FT                   /translation="MIDAGSRTFADRHVGPNAAELAHILELVGADSLDDLASKAVPAVI
FT                   LDGVTGGIADGLDALPAPVSEHEALAELSALAAQNTVATSMIGLGYYDTLTPPVLIRNI
FT                   IENPAWYTAYTPYQPEISQGRLEALLNFQTMVADLTGMEVANSSMLDEATAAAEAMTLL
FT                   RRASKSKSPRFVVDADLFPQTLAVVETRAEPLGIEIVVADLSAGLPDGDFFGVLGQMPG
FT                   ASGRIADYTDVIAAAHERGALVAVGADLLALTLLTPPGEIGADACFGTTQRFGVPMGFG
FT                   GPHAGYLAVHTKHARQLPGRLVGVSVDADGDKAYRLALQTREQHIRREKATSNICTAQV
FT                   LLAILAAMYASYHGAEGLKAIALRVAATAHSLAAALRGTGATVVHEHFFDTILVRVDGR
FT                   AADVVAKAKDAGINLRLVDADHVAVACDEATTDDDVARVLAAFGGDGPVAREAGTSVPE
FT                   SQLRGSDYLQHEAFTRYRTETAMLRYLRALSDKDIALDRSMIPLGSCTMKLNATAEMEA
FT                   ITWPAFAGLHPFAPTGDTPGILRIIKDLENWLVAVTGYDAVSLQPNAGSQGEYAGLLAI
FT                   RNYHLSRGDDHRDTCLIPSSAHGTNAASAVMAGMRVEVVACRPNGDVDLDDLRAKIADH
FT                   AERLAAIMITYPSTHGVYEHEIADICAAVHDAGGQVYVDGANLNALVGLARPGRFGGDV
FT                   SHLNLHKTFCIPHGGGGPGVGPIGVRSHLTPFLPGHPLAPELGTAGPISAAPYGSASIL
FT                   PITWAYIRMMGAVGLRRASLTAIASANYIARRLDEYFPVLYTGEGGMVAHECILDLRPI
FT                   TKDTGVTVDDVAKRLADYGFHAPTMSFPVAGTLMVEPTESENLEEIDAFCEAMIAIRAE
FT                   IDRVGSGEWTVDDNPLRGAPHTAGCLAAEWNHPYTRETAVFPRGKARPKVWPAVRRIDG
FT                   AHGDRNLVCSCPPISAFEGA"
     MIDAGSRTFA DRHVGPNAAE LAHILELVGA DSLDDLASKA VPAVILDGVT GGIADGLDAL        60
     PAPVSEHEAL AELSALAAQN TVATSMIGLG YYDTLTPPVL IRNIIENPAW YTAYTPYQPE       120
     ISQGRLEALL NFQTMVADLT GMEVANSSML DEATAAAEAM TLLRRASKSK SPRFVVDADL       180
     FPQTLAVVET RAEPLGIEIV VADLSAGLPD GDFFGVLGQM PGASGRIADY TDVIAAAHER       240
     GALVAVGADL LALTLLTPPG EIGADACFGT TQRFGVPMGF GGPHAGYLAV HTKHARQLPG       300
     RLVGVSVDAD GDKAYRLALQ TREQHIRREK ATSNICTAQV LLAILAAMYA SYHGAEGLKA       360
     IALRVAATAH SLAAALRGTG ATVVHEHFFD TILVRVDGRA ADVVAKAKDA GINLRLVDAD       420
     HVAVACDEAT TDDDVARVLA AFGGDGPVAR EAGTSVPESQ LRGSDYLQHE AFTRYRTETA       480
     MLRYLRALSD KDIALDRSMI PLGSCTMKLN ATAEMEAITW PAFAGLHPFA PTGDTPGILR       540
     IIKDLENWLV AVTGYDAVSL QPNAGSQGEY AGLLAIRNYH LSRGDDHRDT CLIPSSAHGT       600
     NAASAVMAGM RVEVVACRPN GDVDLDDLRA KIADHAERLA AIMITYPSTH GVYEHEIADI       660
     CAAVHDAGGQ VYVDGANLNA LVGLARPGRF GGDVSHLNLH KTFCIPHGGG GPGVGPIGVR       720
     SHLTPFLPGH PLAPELGTAG PISAAPYGSA SILPITWAYI RMMGAVGLRR ASLTAIASAN       780
     YIARRLDEYF PVLYTGEGGM VAHECILDLR PITKDTGVTV DDVAKRLADY GFHAPTMSFP       840
     VAGTLMVEPT ESENLEEIDA FCEAMIAIRA EIDRVGSGEW TVDDNPLRGA PHTAGCLAAE       900
     WNHPYTRETA VFPRGKARPK VWPAVRRIDG AHGDRNLVCS CPPISAFEGA                  950
//

If you have problems or comments...

PBIL Back to PBIL home page